SecReT6
Protein ID: 403059673
SecReT6 ID692
T6SS typei1
Gene symbol-
Locus tagPCC21_032340
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3661894..3662670 [-]
Producthypothetical protein
NoteTssL
UniProt IDJ7L2J5
KEGG IDpcc:PCC21_032340
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.20E-71, Aligned region: 38..242
Protein Sequence: 258 a.a.     [Download]
>gi|403059673|ref|YP_006647890.1| hypothetical protein PCC21_032340 [Pectobacterium carotovorum subsp. carotovorum PCC21]
MSIEVIKNDQLGDLLFDHARQLDMDSDYWFRLRGQSINPMVDAVTPLLGMVERVRQLSAYEGVEDLYQRV
VSEIQAIEQELHSHGYENGVILSFRYILCTFIDEAVMGREWGGQSMWSAHSLLTRFHNETWGGEKVFVLL
EKLLDDPTRYRDILEFIYLCLCLGFEGRYRVMTQGREELNRVVNKLHDTLRPEPANSPTVFHLNLGQQAS
RYQLRRQVSLRTLFVGVCVVLVAAFGLYRYQLTHQTQDVLRQLGELLQ
 
Nucleotide Sequence: 777 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3662670-3661894 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGAGCATCGAGGTTATTAAAAACGATCAACTGGGCGATCTGCTTTTTGACCACGCCCGCCAGCTGGATA
TGGACTCTGACTACTGGTTCCGCCTGCGTGGACAAAGCATTAATCCAATGGTGGATGCGGTCACGCCGCT
GCTGGGCATGGTAGAGCGGGTGCGCCAGCTCTCTGCCTATGAGGGCGTGGAAGATCTGTATCAGCGCGTG
GTATCTGAAATTCAGGCTATCGAGCAGGAATTACACTCTCATGGCTACGAAAACGGCGTGATCTTGTCGT
TCCGCTACATCCTCTGCACTTTCATTGATGAAGCTGTGATGGGACGGGAGTGGGGCGGCCAAAGCATGTG
GTCGGCCCATTCTCTGTTGACCCGTTTTCACAATGAGACTTGGGGAGGCGAAAAGGTGTTTGTCCTGCTG
GAGAAGCTGCTGGACGACCCTACCCGCTATCGCGACATTCTGGAGTTTATCTACCTCTGCCTCTGTCTGG
GTTTTGAAGGGCGCTATCGGGTGATGACGCAAGGGCGTGAAGAACTGAACCGCGTCGTGAACAAGCTACA
TGACACCCTGCGTCCTGAACCCGCGAATTCGCCGACGGTCTTCCACCTGAATCTGGGGCAGCAAGCCTCG
CGCTACCAACTACGCAGACAGGTGTCATTACGCACGCTATTTGTCGGCGTGTGTGTTGTTTTGGTGGCCG
CCTTCGGCCTGTACCGCTATCAGCTAACTCATCAAACCCAGGACGTACTGCGTCAGCTGGGAGAATTATT
ACAATAA