SecReT6
Protein ID: 403059674
SecReT6 ID692
T6SS typei1
Gene symbol-
Locus tagPCC21_032350
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3662686..3664023 [-]
Producthypothetical protein
NoteTssK
UniProt IDJ7KTG4
KEGG IDpcc:PCC21_032350
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.10E-159, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|403059674|ref|YP_006647891.1| hypothetical protein PCC21_032350 [Pectobacterium carotovorum subsp. carotovorum PCC21]
MSSRNRIIWREGLFIKPQHFQQQQRHTDYALHARLSALSDYFYGLQSLAINEEYLNFGRIALVNASGVMP
DGTVFNIPGDDALPLPLEITDVALANQKVYLALPLAVNGVSEVGQPGQGIASRLQSHRHDVRDLHSDGGD
IVSLEVGKVSLRLMLDRDDRSAYASLAIANILDKRPDGGLILDPNFMPCSISVTAIPTLKRFLGESAGLV
AERARSLAQRIAAPGQQGVADVAEFMMLQLLNRAQPKLSHLARLGTLHPERLHETLVELCGELMTFTDES
RLPPEFPAYRHEHQQASFEPLMMSLRQALSTVLSPRAVSIQLKKQPYGVMVAMVGDAELMASAEFVLAVR
ARMPQEHLRKQLLQQTKIASSEKIRELISLQLPGIPLLPLPVAPRQLPYHAGYSYFQLDRQSPAWQVLVS
GNTLAFHIAGEFPELDMQLWAIRGQ
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3664023-3662686 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGTCGAGTCGCAATCGCATTATCTGGCGGGAAGGTCTGTTCATTAAACCGCAGCATTTTCAACAACAGC
AAAGACACACCGATTACGCACTGCACGCGCGTCTCAGCGCCCTCAGTGACTATTTCTATGGCTTGCAGTC
GCTGGCGATTAATGAGGAATACCTCAATTTTGGCCGCATCGCGCTGGTTAACGCCAGCGGCGTGATGCCG
GACGGCACTGTGTTCAATATTCCGGGCGACGACGCCCTGCCGCTGCCGTTGGAGATTACCGACGTCGCGC
TGGCAAACCAGAAAGTGTATCTGGCGCTGCCGCTGGCGGTAAATGGCGTCAGTGAAGTCGGTCAGCCGGG
GCAGGGGATCGCCAGCCGCCTGCAATCGCACCGGCATGACGTGCGCGACCTGCACAGCGACGGCGGCGAT
ATCGTTTCTCTGGAAGTCGGAAAAGTCAGCCTGCGCCTGATGCTCGATCGTGACGATCGCAGCGCCTATG
CCTCGCTGGCGATTGCCAACATTCTGGATAAACGCCCTGACGGCGGCTTGATTCTGGATCCTAACTTCAT
GCCGTGCAGTATCAGCGTTACCGCGATCCCTACCTTAAAACGCTTTTTGGGGGAATCCGCCGGTCTGGTG
GCGGAACGCGCGCGCAGTCTGGCGCAGCGTATTGCCGCACCGGGACAGCAGGGCGTCGCGGACGTGGCCG
AATTTATGATGCTGCAATTGCTTAACCGCGCGCAGCCCAAGCTGTCGCATCTGGCGCGCCTTGGCACGTT
GCACCCTGAACGCCTGCACGAAACGCTGGTTGAGCTGTGTGGCGAGCTGATGACGTTTACCGATGAGTCG
CGTCTGCCGCCTGAATTCCCCGCCTATCGTCACGAACACCAGCAGGCCAGCTTTGAGCCGCTGATGATGT
CACTGCGTCAGGCGCTGAGCACCGTGCTGTCGCCGCGCGCCGTCTCCATCCAACTGAAGAAACAGCCGTA
TGGCGTGATGGTGGCGATGGTTGGCGATGCGGAATTGATGGCCAGCGCCGAGTTTGTCCTGGCGGTGCGT
GCGCGTATGCCGCAGGAGCATCTGCGTAAACAGCTGCTGCAACAAACGAAGATCGCCTCCAGCGAGAAGA
TCCGCGAACTGATCAGCCTGCAATTGCCGGGTATCCCGCTGCTGCCGCTGCCGGTTGCGCCGCGCCAGCT
GCCTTATCACGCGGGCTACAGCTATTTCCAACTGGATAGACAAAGCCCCGCCTGGCAGGTGCTGGTGTCT
GGCAACACGCTGGCGTTCCACATTGCTGGCGAATTCCCGGAACTGGATATGCAGCTTTGGGCTATCCGTG
GGCAGTAG