SecReT6
Protein ID: 403059675
SecReT6 ID692
T6SS typei1
Gene symbol-
Locus tagPCC21_032360
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3664026..3664547 [-]
Productlipoprotein
NoteTssJ
UniProt IDJ7L1I6
KEGG IDpcc:PCC21_032360
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.80E-37, Aligned region: 11..164
Protein Sequence: 173 a.a.     [Download]
>gi|403059675|ref|YP_006647892.1| lipoprotein [Pectobacterium carotovorum subsp. carotovorum PCC21]
MLRALCLCSLMFLLSGCTTLGKMAQVAANPDIQVGSNNHQPSTVGFSLLAEPDVNPNDSGEAAPIEFQLV
LLAEDSRLLATDYDQITTDIEKALAKNYINHQDYTLLPGQFKYLPPEALDEKVHYLGVVARYADSESAEW
RKVIKLKNTGQTYQILVHLRRDEVEIKKDQEEE
 
Nucleotide Sequence: 522 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3664547-3664026 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGCTGCGGGCTCTGTGCTTATGTTCCCTGATGTTCCTGCTGTCGGGGTGTACCACGCTGGGCAAGATGG
CGCAGGTGGCGGCGAATCCCGACATTCAGGTAGGCAGTAATAATCATCAGCCTTCTACCGTGGGGTTTAG
CTTGCTGGCGGAACCGGACGTTAACCCGAATGACAGCGGTGAAGCCGCACCTATCGAATTCCAACTGGTG
CTGTTGGCGGAGGATTCGCGTCTGTTAGCCACCGATTACGACCAAATCACGACGGATATCGAAAAGGCAT
TAGCGAAGAATTACATCAATCATCAGGACTACACGCTGCTGCCGGGGCAGTTCAAGTATCTGCCGCCCGA
AGCGCTGGATGAAAAAGTGCACTACCTCGGCGTTGTGGCGCGCTATGCGGATTCGGAAAGCGCAGAGTGG
CGCAAAGTCATCAAGCTAAAGAATACCGGGCAGACGTATCAGATCCTCGTGCACCTGCGCAGGGATGAAG
TCGAAATCAAAAAAGACCAAGAAGAAGAATAA