SecReT6
Protein ID: 403059677
SecReT6 ID692
T6SS typei1
Gene symbol-
Locus tagPCC21_032380
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3665770..3666768 [-]
Producthypothetical protein
NoteTssG
UniProt IDJ7KVT6
KEGG IDpcc:PCC21_032380
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.80E-96, Aligned region: 16..319
Protein Sequence: 332 a.a.     [Download]
>gi|403059677|ref|YP_006647894.1| hypothetical protein PCC21_032380 [Pectobacterium carotovorum subsp. carotovorum PCC21]
MAGTDRSTLNDVTFRQDVSRFNFFQLVELLNQLEGVDLEQELDFRPEQERLRFRSTASIGFHPSDILQVG
RDEDGRQELEVAFLGLHGSQSPMPGYYLEELAWEYAQGEQKLGVFLDFFHHRLLTLLHRAWRKYRYHVRF
QNEGEDGFSRLMFALVGLGNDAVRDSLPVNRAKMLSYAGVLASPSRSPEVVAGLVIHCFDLDDVAVLAWQ
HRRVPIHEGQQNRLGKGNMMLGGDFVIGDKVNDCAGKFLLKVGNLSFSRFLSFLPNGEHFQPLVRFVSFI
LRDQLAWDLRLGFAEGEAKGLSLGSEQSSRLGWSSFLGQPPADPYVTICVQE
 
Nucleotide Sequence: 999 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3666768-3665770 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGGCCGGTACAGATAGGTCAACACTCAATGATGTGACGTTCCGTCAGGATGTCTCACGCTTTAATTTTT
TCCAGTTGGTGGAGTTACTTAACCAGCTGGAAGGCGTGGATCTGGAACAAGAGCTGGATTTCCGCCCTGA
ACAGGAACGCCTGCGCTTTCGCTCTACGGCCTCCATCGGTTTTCACCCCAGCGATATCTTGCAGGTGGGA
CGTGATGAAGATGGCCGTCAGGAGCTGGAAGTCGCGTTTCTTGGCCTGCACGGCAGTCAGTCACCGATGC
CCGGTTATTACCTCGAAGAGCTGGCCTGGGAATATGCGCAGGGCGAACAGAAGCTGGGCGTGTTTCTAGA
CTTCTTTCATCACCGTTTACTTACGCTACTGCACCGCGCATGGCGCAAATACCGCTATCACGTCCGCTTT
CAGAATGAGGGGGAGGATGGATTCTCCCGCCTGATGTTTGCGCTGGTGGGGTTAGGGAATGATGCCGTAC
GCGACAGCCTGCCGGTTAACCGCGCCAAGATGCTTTCCTACGCCGGGGTGCTCGCCAGCCCCAGCCGCTC
CCCGGAAGTGGTCGCGGGCTTGGTTATTCACTGTTTTGATCTGGATGACGTGGCTGTTCTGGCCTGGCAG
CACCGTCGCGTGCCCATTCACGAAGGGCAGCAGAACCGCTTGGGCAAAGGAAACATGATGTTGGGTGGTG
ATTTTGTTATCGGCGACAAAGTGAATGACTGCGCCGGCAAGTTTTTGCTCAAGGTCGGCAATCTCAGCTT
TAGCCGCTTTCTCAGCTTCTTGCCCAACGGCGAGCATTTTCAGCCGTTGGTGCGTTTTGTCTCTTTCATT
CTTCGCGATCAGTTGGCCTGGGATCTGCGTCTGGGTTTTGCGGAAGGCGAAGCCAAGGGCTTAAGTCTGG
GCAGTGAGCAAAGCAGCCGGTTGGGATGGAGCAGCTTTCTCGGGCAGCCGCCCGCGGATCCCTATGTGAC
GATTTGTGTGCAGGAGTAA