SecReT6
Protein ID: 403059678
SecReT6 ID692
T6SS typei1
Gene symbol-
Locus tagPCC21_032390
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3666732..3668498 [-]
Producthypothetical protein
NoteTssF
UniProt IDJ7L2J8
KEGG IDpcc:PCC21_032390
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-200, Aligned region: 3..587
Protein Sequence: 588 a.a.     [Download]
>gi|403059678|ref|YP_006647895.1| hypothetical protein PCC21_032390 [Pectobacterium carotovorum subsp. carotovorum PCC21]
MSLEHFFRDELTYLRLQGREFAKAHPELTRFLSEQTTDPDVERLLEGFAFLTGSLRAKIEDEFPELTHGL
LGMLWPNYLRPVPSMTIMQFSVLPGAIAQPAFVERGCELDSLPIDDVVCHFQTCHDAWIYPADIREIKVQ
SGNDLSTITLDIGLHGPLSLSDLQLDKLRFYLGGDTYTAYELYFWIASQLSHIELEVDGQRFRQEASVLK
TVGFEREDALLPYPGNVYSGYRILQEYFCFPESFLFFQLAGAVWPELPLTVTEFRLHFCFDRPLPAELKI
RPDSFMLNCVPAINLFQHDSEPINLSGRQTDYPLKASYRNADSFEIFSVDKVEGWVEGNSGRARGIPRTY
QPFESFQHQIERAKGRLALYYRIRVREAVNGNGFDHMLSFVRGDEQEVIDLDESISVTLTCTNRSRAAKL
PVGSICVPTGNSPSFATFRNLVRPTRPLRPAMDGSLHWTLISNLSLNYVSLLRRDALVQILRTYDFPALH
DKQAEQASRKRLAGIESIETTPIDRLVQGMPVRGLKSILSVRQSAFSSEGELYLFSTVLAHFFSLYASVN
AFHLLEVVNIDNKERYRWPVQIGQHSMM
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3668498-3666732 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGTCACTGGAACATTTTTTCAGGGATGAGCTGACCTACTTGCGCCTGCAAGGGCGTGAATTCGCCAAGG
CGCACCCTGAGCTTACCCGATTTTTGTCAGAACAAACCACGGATCCAGACGTCGAGCGTCTGCTGGAAGG
GTTCGCCTTTTTGACAGGGAGCCTGCGGGCGAAGATCGAGGATGAATTTCCGGAACTGACACACGGTCTG
CTGGGCATGCTGTGGCCTAATTACCTGCGCCCCGTACCGAGCATGACGATTATGCAGTTTTCGGTACTCC
CCGGCGCGATTGCCCAGCCCGCGTTTGTTGAACGCGGCTGTGAGCTTGATAGTCTGCCGATTGATGATGT
GGTGTGCCATTTTCAGACCTGCCACGACGCCTGGATTTATCCAGCGGATATCCGTGAGATCAAGGTACAG
AGCGGTAACGATCTTTCCACCATCACGCTGGATATTGGGCTGCATGGCCCGCTATCGTTAAGCGATCTAC
AACTCGACAAGCTGCGCTTTTATCTGGGCGGTGATACCTATACGGCCTACGAACTCTATTTCTGGATTGC
CAGCCAACTGTCGCACATTGAGCTGGAAGTCGATGGTCAGCGCTTCCGTCAGGAAGCCAGCGTGCTGAAA
ACGGTCGGCTTTGAGCGGGAAGATGCGCTATTGCCGTATCCCGGTAACGTCTATTCTGGCTACCGCATTC
TGCAGGAATACTTTTGTTTTCCTGAAAGTTTCCTCTTTTTCCAACTCGCGGGCGCGGTATGGCCGGAGCT
TCCGCTGACGGTAACGGAATTCCGTCTGCATTTTTGCTTTGACCGCCCGCTGCCGGCGGAACTGAAGATC
CGCCCTGATTCGTTCATGCTCAACTGCGTGCCGGCAATCAATCTCTTCCAGCATGATAGCGAGCCGATCA
ACCTCAGCGGACGCCAGACGGATTACCCGCTGAAAGCCAGCTACCGCAACGCCGATAGCTTTGAAATCTT
CTCTGTGGATAAGGTTGAAGGCTGGGTTGAAGGGAATTCAGGTCGTGCTCGGGGGATTCCACGCACCTAT
CAGCCGTTTGAGAGCTTTCAGCACCAAATCGAACGTGCCAAAGGACGGCTCGCGCTCTATTACCGTATTC
GGGTAAGGGAAGCGGTGAACGGCAACGGGTTTGATCACATGCTCTCTTTTGTGCGTGGTGATGAGCAGGA
AGTGATTGATTTAGATGAATCCATCTCGGTCACGCTGACTTGTACCAACCGATCGCGTGCGGCGAAACTG
CCTGTTGGGTCGATCTGCGTGCCAACCGGCAATTCGCCGTCTTTCGCGACGTTTCGCAATCTGGTACGGC
CGACGCGACCGCTGCGGCCTGCCATGGATGGCAGCCTGCACTGGACGCTGATCTCCAACCTGTCTCTGAA
CTATGTGTCGCTGCTGCGGCGCGATGCGCTGGTGCAAATTCTGCGTACTTATGATTTCCCTGCACTGCAC
GACAAGCAGGCGGAACAAGCCTCGCGTAAGCGTCTGGCAGGGATCGAATCTATCGAAACCACGCCTATCG
ATCGTCTGGTGCAGGGGATGCCGGTTCGCGGCTTGAAATCCATCCTGTCAGTACGGCAATCCGCGTTTTC
CAGTGAAGGAGAACTCTATCTGTTTAGTACGGTGCTGGCGCACTTCTTCTCGCTATACGCCAGCGTCAAC
GCTTTCCACCTGTTGGAAGTGGTCAACATCGATAACAAGGAGCGCTACCGATGGCCGGTACAGATAGGTC
AACACTCAATGATGTGA