SecReT6
Protein ID: 403059679
SecReT6 ID692
T6SS typei1
Gene symbol-
Locus tagPCC21_032400
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3668501..3668932 [-]
Producthypothetical protein
NoteTssE
UniProt IDJ7KTG9
KEGG IDpcc:PCC21_032400
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.40E-20, Aligned region: 32..123
Protein Sequence: 143 a.a.     [Download]
>gi|403059679|ref|YP_006647896.1| hypothetical protein PCC21_032400 [Pectobacterium carotovorum subsp. carotovorum PCC21]
MPSLSAWERGNAASLFDRIRGEERRSSPETEVEALIESVKRQLDNVLNTRPGNCRSAPELGVIDFNDATQ
GGADIRGKIREAIRQCICRFEPRIVHVDVDTSDYLSNPMEMSFQVTARVRLEDLEQVASFNIHMDSHRHY
RMI
 
Nucleotide Sequence: 432 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3668932-3668501 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGCCGTCTCTTTCTGCCTGGGAAAGGGGAAACGCGGCAAGTCTGTTTGATCGTATCCGTGGGGAGGAGC
GTCGCTCCTCCCCTGAAACGGAAGTTGAAGCACTGATCGAGTCCGTTAAGCGTCAATTGGACAATGTGCT
CAACACCCGGCCCGGAAATTGCCGCAGCGCACCTGAGCTTGGCGTGATTGATTTTAATGACGCGACGCAG
GGTGGGGCGGACATTCGAGGGAAAATCCGGGAGGCGATCCGACAGTGTATCTGTCGCTTTGAACCGCGAA
TTGTTCATGTGGATGTCGACACATCGGACTATTTATCGAATCCGATGGAGATGTCGTTTCAGGTTACCGC
CCGGGTCAGATTGGAAGATCTGGAGCAGGTTGCCTCTTTCAATATCCATATGGATAGCCACCGCCACTAC
AGAATGATCTGA