SecReT6
Protein ID: 403059680
SecReT6 ID692
T6SS typei1
Gene symbol-
Locus tagPCC21_032410
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3668938..3670416 [-]
Producthypothetical protein
NoteTssC
UniProt IDJ7L1I8
KEGG IDpcc:PCC21_032410
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.20E-185, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|403059680|ref|YP_006647897.1| hypothetical protein PCC21_032410 [Pectobacterium carotovorum subsp. carotovorum PCC21]
MSIVEEQVQAGAASASGSLLDDIMAQARISPVDEGYSVAKQGIAALVANILDSGNAAEPVNKALVDSMIV
ELDKKLSKQIDVILHAKELQELESSWRSMKLLVDRTDFRENIKLLVLHATKEELLEDFEFAPEISQSGFY
KHVYSSGYGQFGGQPIGGVIGDYALTQSSPDIKLMQYVSAVGAMAHAPFISSVAPTFFGVDRFTDLPSIK
DLKSVFEGPAYTKWRSLRESEDGRYLGLTAPRFLARLPYDPVENPIKGFNYKEDISTDHEHYLWGNTAYL
MGTALTDSFAKYRWCPNIIGPQSGGAITDLPVHVYEAMGQLQAKIPTEVLITDRREYEMAEEGFITLTMR
KDSDNAAFFSANSVQKPKVFPNTKEGKEAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLE
RELNTWIKQYIADQENPPADVRSRRPLRAAQIKVLDVEGEPGWYQVTMSVRPHFKYMGANFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3670416-3668938 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGTCAATAGTTGAAGAACAGGTTCAGGCAGGAGCCGCCAGTGCTTCTGGATCGCTGCTTGATGACATCA
TGGCTCAAGCGCGTATCAGCCCGGTTGATGAAGGCTACAGTGTTGCTAAACAGGGCATTGCCGCGCTGGT
CGCTAACATTCTTGATAGCGGTAATGCAGCAGAACCCGTGAACAAAGCGCTGGTCGATAGCATGATCGTC
GAACTGGACAAAAAGCTCAGCAAGCAGATTGACGTTATTCTGCATGCGAAAGAATTACAGGAACTGGAAT
CTTCCTGGCGTTCAATGAAACTGCTGGTTGATCGCACCGATTTCCGCGAAAACATCAAACTGTTGGTGTT
GCATGCGACGAAAGAAGAGCTGTTGGAAGATTTCGAATTCGCCCCTGAAATCTCACAGTCTGGCTTCTAT
AAGCACGTGTATTCCAGCGGCTACGGCCAGTTTGGTGGTCAGCCTATCGGTGGCGTAATCGGTGACTATG
CGCTGACGCAAAGTTCACCAGATATCAAGCTGATGCAGTATGTCAGCGCCGTGGGTGCGATGGCGCATGC
GCCGTTCATCTCGTCCGTTGCGCCGACCTTCTTTGGCGTGGATCGCTTCACCGATCTGCCTTCCATCAAA
GATCTGAAATCCGTTTTCGAAGGCCCAGCCTACACGAAATGGCGTTCGCTGCGTGAGTCCGAAGATGGTC
GCTATCTGGGGCTGACGGCACCGCGCTTCCTGGCTCGCCTGCCTTATGACCCGGTAGAGAACCCGATTAA
GGGCTTCAACTACAAGGAAGATATCAGCACCGATCACGAACACTATCTGTGGGGCAATACCGCCTATCTG
ATGGGAACGGCGTTGACCGACAGCTTCGCGAAATACCGCTGGTGTCCGAATATCATTGGCCCGCAGAGCG
GCGGTGCGATTACCGACCTGCCCGTGCATGTGTATGAAGCCATGGGCCAACTTCAGGCCAAGATCCCGAC
TGAAGTCCTGATCACCGATCGTCGCGAATACGAAATGGCTGAAGAAGGCTTTATCACGCTGACGATGCGT
AAAGACAGTGACAACGCGGCGTTCTTCTCGGCTAACTCGGTGCAGAAGCCGAAGGTGTTCCCAAACACCA
AAGAAGGTAAAGAAGCGGAAACCAACTACAAGCTGGGTACGCAACTGCCGTACATGTTCATCATCAACCG
TCTGGCGCACTACATCAAAGTGCTGCAGCGTGAACAGATTGGCTCATGGAAAGAGCGTCAGGATCTTGAG
CGTGAGTTGAATACCTGGATTAAACAGTACATCGCCGATCAGGAAAACCCGCCGGCAGATGTTCGTAGCC
GTCGCCCTCTGCGTGCCGCACAAATCAAAGTGCTGGATGTAGAAGGGGAACCTGGTTGGTATCAGGTCAC
CATGTCTGTGCGCCCGCACTTCAAGTACATGGGGGCGAACTTTGAGCTGTCGCTGGTAGGGCGTTTGGAT
AAGGAATAA