SecReT6
Protein ID: 403059681
SecReT6 ID692
T6SS typei1
Gene symbol-
Locus tagPCC21_032420
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3670574..3671077 [-]
Producthypothetical protein
NoteTssB
UniProt IDJ7KZP2
KEGG IDpcc:PCC21_032420
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.80E-57, Aligned region: 9..161
Protein Sequence: 167 a.a.     [Download]
>gi|403059681|ref|YP_006647898.1| hypothetical protein PCC21_032420 [Pectobacterium carotovorum subsp. carotovorum PCC21]
MAKGTDGASVAPKERINIKYVPATGGQQAEIELPLTLMIVGNMKGRTEETPIEERQTVSIDKNNFTSVMK
EANLELNFSVPNRLEEESQDELPVKLSIGGLNDFSPDRIAQQVPELRKLLDLREALVALKGPLGNIPSFR
NRLQDLLSSEEAREQLLKELDLVKPAE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3671077-3670574 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGGCAAAAGGAACTGATGGTGCATCTGTCGCACCAAAGGAACGTATTAATATCAAATATGTTCCGGCCA
CTGGTGGTCAGCAGGCGGAAATAGAATTGCCGTTGACGCTGATGATCGTGGGAAATATGAAAGGGCGCAC
AGAGGAAACGCCGATCGAAGAACGTCAGACCGTATCGATCGATAAGAACAACTTTACCTCAGTGATGAAA
GAAGCAAATCTGGAATTGAATTTCAGTGTGCCAAACCGCCTTGAAGAAGAAAGCCAGGACGAGCTGCCAG
TGAAACTGAGCATCGGCGGTCTGAATGATTTCTCCCCTGACCGCATTGCCCAACAGGTGCCTGAATTACG
TAAGTTGCTTGATTTACGTGAAGCACTGGTGGCGCTGAAAGGCCCCCTCGGCAATATTCCCTCATTCCGT
AATCGTTTGCAGGATCTGTTGTCCAGCGAAGAAGCCAGAGAGCAGCTTTTGAAAGAGCTCGATCTGGTCA
AACCCGCCGAATAA