SecReT6
Protein ID: 403520326
SecReT6 ID693
T6SS typei4b
Gene symbol-
Locus tagBPC006_I3711
StrainBurkholderia pseudomallei BPC006
Repliconchromosome I [GenBank: NC_018527] [Browse all T6SS(s) in this replicon]
Location [Strand]3586910..3588748 [-]
Producthypothetical protein
NoteTssF
UniProt IDK7PVW9
KEGG IDbpq:BPC006_I3711
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.50E-212, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|403520326|ref|YP_006654460.1| hypothetical protein BPC006_I3711 [Burkholderia pseudomallei BPC006]
MEELLPYYERELSFLRRYSLEFANRYPKIAARLAQTGEQCEDPHVERMIESFALLGARINKKLDDEYPEF
TEALVEVLYPHYLRPFPSCSIAQFGAPHAFAELTEPRIVERGTELKSRAIRGVQCRFRTAYDVTLAPIRL
ADARYGSVAVAPAAARLPGNATGVISIAFESTSPQLDLAALKLGKLRAHLHGEQSFVAALADCLFAHALA
CYVEPDRGGRWIALGKTPFEHAGFDETDALIDYPARSHPAYRLLTEYFAFPDKFNFVDFDLGALARRAGP
CRQLTLHIALRDVRGDSHVARLLDLLSASHFRLFCTPVVNLFRQHGEPIRVDHRAVSYPVIGDARRAFAY
EVYSIDSVHLVRQRADRETLVEFRPFYSLHHGEAAQAGHYWFARRNDDVARKSPGYETEISVVDVDFEPG
APQTDTLSLDLTCTNRDLPAALATGLDGGDLFIDGGEQPGPIALLRRPTPSARFERGHAAHWRLVSHLAL
NHVSLAEEGLAALKEALVLYDLRRSAVSTRHIDGIVGIEQKSAVQWLPGKPFATFVRGVEIRLAIDDEHF
VGSSLATFVRMIDAFFGLYVHLNSFVQLIVVSRRTGEEIMRCKPRSGESILA
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|403516668|ref|NC_018527.1|:c3588748-3586910 Burkholderia pseudomallei BPC006 chromosome I, complete sequence
ATGGAAGAGTTGTTGCCGTATTACGAACGCGAACTGTCGTTTCTGCGGCGCTATTCGCTCGAATTCGCGA
ACCGTTACCCGAAGATCGCCGCGCGTCTCGCCCAGACGGGCGAGCAGTGCGAGGATCCGCACGTCGAGCG
GATGATCGAATCGTTCGCGCTGCTCGGCGCGCGGATCAACAAGAAGCTCGACGACGAATATCCCGAGTTC
ACCGAAGCGCTCGTCGAAGTCCTCTACCCGCACTATCTGCGGCCGTTCCCGTCATGCTCGATCGCGCAGT
TCGGTGCGCCGCATGCGTTCGCGGAGCTCACCGAGCCGCGGATCGTCGAGCGCGGCACCGAGCTGAAGAG
CCGCGCGATTCGCGGCGTGCAGTGCCGGTTCCGCACCGCGTACGACGTGACGCTCGCGCCGATCCGGCTC
GCCGATGCGCGCTACGGATCGGTCGCGGTGGCGCCCGCCGCAGCAAGGCTGCCCGGCAACGCGACGGGCG
TGATCTCGATCGCGTTCGAATCGACGTCGCCGCAGCTCGATCTTGCCGCGCTGAAGCTCGGCAAGCTGCG
CGCGCATTTGCACGGCGAGCAATCGTTCGTCGCCGCGCTGGCCGATTGCCTGTTCGCGCACGCGCTCGCC
TGCTACGTCGAGCCCGATCGCGGCGGCCGCTGGATCGCGCTCGGCAAGACGCCGTTCGAGCACGCGGGCT
TCGACGAGACCGACGCGCTGATCGACTATCCGGCCCGTTCGCACCCGGCCTATCGGCTGCTGACCGAATA
CTTCGCATTCCCGGATAAATTCAACTTCGTCGATTTCGATCTGGGCGCACTCGCGCGGCGCGCGGGGCCC
TGCCGGCAGCTGACGCTGCACATCGCGCTGCGCGACGTGCGCGGCGATTCGCATGTCGCGCGGCTGCTCG
ATCTGCTGAGCGCGAGCCATTTCCGGCTCTTCTGCACGCCGGTCGTGAACCTGTTCCGCCAGCACGGCGA
GCCGATTCGGGTCGACCACCGGGCGGTGTCGTACCCGGTGATCGGCGATGCGCGCCGCGCGTTCGCGTAC
GAGGTATATTCGATCGATTCGGTGCATCTCGTGCGGCAGCGCGCGGACCGCGAAACGCTCGTCGAATTCC
GGCCGTTCTATTCGCTGCATCACGGCGAAGCCGCGCAGGCCGGCCACTACTGGTTCGCGCGGCGCAACGA
CGACGTCGCGCGCAAGAGCCCCGGCTACGAGACCGAGATTTCGGTCGTCGACGTCGACTTCGAGCCGGGC
GCGCCGCAAACCGATACGTTGAGCCTCGATCTCACCTGTACGAACCGCGACCTGCCCGCCGCGCTCGCAA
CGGGGCTCGACGGCGGCGATCTCTTCATCGACGGCGGCGAGCAGCCCGGCCCGATCGCGCTATTGCGCCG
GCCGACGCCGAGCGCGCGCTTCGAGCGCGGCCACGCCGCGCACTGGCGCCTCGTGTCGCATCTCGCGCTC
AATCACGTGTCGCTTGCCGAAGAAGGGCTCGCCGCGCTGAAGGAAGCGCTCGTGCTGTACGATCTGAGGC
GCTCCGCGGTGTCGACGCGCCATATCGACGGGATCGTCGGCATCGAGCAGAAGAGCGCGGTGCAATGGCT
GCCGGGCAAGCCGTTCGCGACGTTCGTGCGCGGCGTCGAGATCCGGCTCGCGATCGACGACGAACATTTC
GTCGGCTCGAGCCTCGCGACGTTCGTGCGGATGATCGACGCGTTCTTCGGGCTGTACGTGCACCTCAACA
GCTTTGTTCAACTGATCGTCGTGTCCAGGCGCACCGGCGAGGAGATCATGCGATGCAAACCGCGCAGCGG
CGAATCGATCCTGGCGTAG