SecReT6
Protein ID: 403520327
SecReT6 ID693
T6SS typei4b
Gene symbol-
Locus tagBPC006_I3712
StrainBurkholderia pseudomallei BPC006
Repliconchromosome I [GenBank: NC_018527] [Browse all T6SS(s) in this replicon]
Location [Strand]3588828..3589310 [-]
Producthypothetical protein
NoteTssE
UniProt IDK7Q9M3
KEGG IDbpq:BPC006_I3712
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.00E-22, Aligned region: 29..137
Protein Sequence: 160 a.a.     [Download]
>gi|403520327|ref|YP_006654461.1| hypothetical protein BPC006_I3712 [Burkholderia pseudomallei BPC006]
MKRFEPSFLDKLFDDEPHVPAPAAMRQLSLEELKNTVARDVEAILNTRIALTEEDLAELPECQRSVLTYG
LNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVQVAFELNEQSTNALYFAIQALLVVHPAEEPVTFD
AMLQPSTLQYSVTRSRAAKV
 
Nucleotide Sequence: 483 bp     [Download]
>gi|403516668|ref|NC_018527.1|:c3589310-3588828 Burkholderia pseudomallei BPC006 chromosome I, complete sequence
ATGAAACGTTTCGAACCGAGCTTCCTCGACAAGCTGTTCGACGACGAACCGCACGTGCCGGCGCCCGCCG
CGATGCGGCAGTTGTCGCTGGAGGAGCTGAAGAACACGGTCGCGCGCGACGTCGAGGCGATCCTCAACAC
GCGCATCGCGCTGACCGAAGAAGATCTCGCCGAGCTGCCCGAATGCCAGCGCTCGGTGCTGACCTACGGG
CTGAACGATTTCGCCGGCCTGAGCCTCGCGAGCCACTACGATCGCACGTTCATCTGCAAATCGATTCAGC
AGGCGATCGCGCGGCACGAGCCGAGGCTGCAGCAGGTGCAGGTGGCGTTCGAGCTGAACGAGCAGTCGAC
GAACGCGCTCTATTTCGCGATCCAGGCGCTGCTCGTCGTGCATCCCGCCGAGGAACCGGTGACCTTCGAT
GCGATGCTGCAGCCGTCGACGTTGCAATATTCGGTGACGCGTTCGCGCGCCGCCAAGGTGTGA