SecReT6
Protein ID: 403520328
SecReT6 ID693
T6SS typei4b
Gene symbol-
Locus tagBPC006_I3713
StrainBurkholderia pseudomallei BPC006
Repliconchromosome I [GenBank: NC_018527] [Browse all T6SS(s) in this replicon]
Location [Strand]3589368..3589862 [-]
Producthypothetical protein
NoteTssD
UniProt IDK7PWI5
KEGG IDbpq:BPC006_I3713
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.60E-45, Aligned region: 3..136
Protein Sequence: 164 a.a.     [Download]
>gi|403520328|ref|YP_006654462.1| hypothetical protein BPC006_I3713 [Burkholderia pseudomallei BPC006]
MHLKFGSPAIKGESADKDHEGWIELKSWDHSIVQPRSATASTAGGHTATRCEHGDMVFTKEIDSSSPLLY
QHASGGTTFDEVTIDFLRADGEGQRVKYLEIKLKYVIISSIAPSVHTEGLPVETFSLKYAAVQWKQTQQK
IGGNQGGNTQGAWSLTKNDKTYAV
 
Nucleotide Sequence: 495 bp     [Download]
>gi|403516668|ref|NC_018527.1|:c3589862-3589368 Burkholderia pseudomallei BPC006 chromosome I, complete sequence
ATGCATTTGAAGTTCGGTAGTCCCGCCATCAAGGGCGAGTCCGCTGACAAGGACCACGAAGGCTGGATCG
AGCTGAAATCCTGGGATCACTCGATCGTTCAGCCGCGTTCGGCGACCGCGTCGACGGCGGGCGGCCACAC
GGCGACGCGTTGCGAGCACGGCGACATGGTGTTCACGAAGGAAATCGATTCGTCGAGCCCGCTGCTGTAT
CAGCACGCGTCGGGCGGCACCACGTTCGACGAAGTGACGATCGATTTCCTGCGCGCGGACGGCGAAGGCC
AGCGCGTGAAGTATCTCGAGATCAAGCTGAAGTACGTGATCATCTCGAGCATCGCGCCGAGCGTGCATAC
CGAAGGCCTGCCGGTCGAGACCTTCTCGCTGAAGTACGCCGCGGTCCAGTGGAAGCAGACGCAGCAGAAG
ATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGCCTCACGAAGAACGACAAGACCTACGCGG
TCTAA