SecReT6
Protein ID: 403520330
SecReT6 ID693
T6SS typei4b
Gene symbol-
Locus tagBPC006_I3715
StrainBurkholderia pseudomallei BPC006
Repliconchromosome I [GenBank: NC_018527] [Browse all T6SS(s) in this replicon]
Location [Strand]3591451..3591969 [-]
Producthypothetical protein
NoteTssB
UniProt IDK7Q4M1
KEGG IDbpq:BPC006_I3715
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.10E-59, Aligned region: 11..164
Protein Sequence: 172 a.a.     [Download]
>gi|403520330|ref|YP_006654464.1| hypothetical protein BPC006_I3715 [Burkholderia pseudomallei BPC006]
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEIKELPFVVGVVGDLAGQSEIEQPKLRDRKFVNIDRDNF
DDVMKAIEPRATFQVENRLSEAGGKFAVDLKFRSINDFNPDEVVGQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLSNTQQLEALKKSADGGDKQGE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|403516668|ref|NC_018527.1|:c3591969-3591451 Burkholderia pseudomallei BPC006 chromosome I, complete sequence
ATGGCGAAGAAAGAAAGCATTCAAAAGCGCTTGCAGAAAGTGCGGCCGCCCCGCGTCCAGTTGACGTACG
AGGTCGAACGGGGCGATGCGATCGAGATCAAGGAGCTGCCGTTCGTCGTCGGGGTCGTCGGCGATCTGGC
GGGGCAGTCCGAAATCGAGCAGCCGAAGCTGCGCGATCGCAAGTTCGTCAACATCGACCGCGACAACTTC
GATGACGTGATGAAGGCGATCGAGCCGCGCGCGACGTTCCAGGTGGAGAACCGCCTGAGCGAGGCGGGCG
GCAAGTTCGCGGTCGACCTGAAGTTCCGCTCGATCAACGATTTCAATCCGGACGAAGTCGTCGGGCAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCGAAGCTCGCGGACCTGCGCAACAAACTGGCCGGCAAC
GACAAGCTCGAAGACCTGCTGAGCGAAGTGCTGTCGAACACGCAGCAGCTCGAAGCGCTGAAGAAGAGCG
CGGACGGCGGCGACAAGCAGGGCGAATGA