SecReT6
Protein ID: 403520333
SecReT6 ID693
T6SS typei4b
Gene symbol-
Locus tagBPC006_I3718
StrainBurkholderia pseudomallei BPC006
Repliconchromosome I [GenBank: NC_018527] [Browse all T6SS(s) in this replicon]
Location [Strand]3593051..3593665 [+]
Productlipoprotein
NoteTssJ
UniProt IDK7PWI8
KEGG IDbpq:BPC006_I3718
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.40E-37, Aligned region: 15..176
Protein Sequence: 204 a.a.     [Download]
>gi|403520333|ref|YP_006654467.1| lipoprotein [Burkholderia pseudomallei BPC006]
MNPHVTRYALPLAACILLGGCAAAVPLLGSAGSAALQMVGVGKPDVPDSQKPPRNLGLTLYAAQNLNAAN
DNRPLALVVRLYALKDPTSFQQAPFDSFTDPTKEKTALGADLLSVREITLIPGQHYNATEKVSREAQAFG
VVALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTGGTVIPSQQGMPTQRLDLLSSVNCG
 
Nucleotide Sequence: 615 bp     [Download]
>gi|403516668|ref|NC_018527.1|:3593051-3593665 Burkholderia pseudomallei BPC006 chromosome I, complete sequence
ATGAATCCGCATGTGACTCGTTACGCGCTGCCGCTCGCCGCCTGCATTCTGCTCGGCGGCTGCGCGGCCG
CCGTGCCGCTCCTCGGTTCGGCGGGCAGCGCCGCGCTGCAGATGGTGGGCGTCGGCAAACCCGACGTGCC
CGATTCGCAGAAGCCGCCGCGCAATCTCGGCCTCACGCTCTATGCGGCACAGAACCTCAACGCCGCGAAC
GACAACCGTCCGCTCGCGCTCGTCGTGCGCCTCTACGCGCTGAAAGATCCGACGTCGTTCCAGCAGGCGC
CGTTCGACAGCTTCACCGATCCGACGAAAGAAAAGACCGCGCTCGGCGCCGATCTGCTGAGCGTGCGCGA
AATCACGCTGATTCCGGGGCAGCACTACAACGCGACCGAAAAGGTGTCGCGCGAAGCGCAGGCATTCGGC
GTCGTCGCGCTTTTTCGCGATCCGGCGCTACAACGCTGGAAACTAACTTTCGATCCGGCGAAATCCGAGA
AATCCGGCATAATCATTGGCCTGCACAACTGCGCGATGACCGTGACGGGCGGCACCGTCATCCCTTCGCA
GCAAGGCATGCCGACGCAGCGGCTCGATTTGCTGTCGTCGGTGAACTGCGGGTGA