SecReT6
Protein ID: 403520334
SecReT6 ID693
T6SS typei4b
Gene symbol-
Locus tagBPC006_I3719
StrainBurkholderia pseudomallei BPC006
Repliconchromosome I [GenBank: NC_018527] [Browse all T6SS(s) in this replicon]
Location [Strand]3593774..3595120 [+]
Producthypothetical protein
NoteTssK
UniProt IDK7Q5D4
KEGG IDbpq:BPC006_I3719
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-135, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|403520334|ref|YP_006654468.1| hypothetical protein BPC006_I3719 [Burkholderia pseudomallei BPC006]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRFDRDALGSNVLRASELSLVFP
DGALYSAPQADELPPPIALDTLPEGINEFTFYLALHPLRETGSNYADDRDAGFVSRFVSEQASVADHFTD
AAEADITFLKTNVKLIAHSEPRDQLLSIPLVRVRRTATSGFEIDDGFVPPCLAIEASPILHQRLRQLIDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTASAAFAALAHLHQHSALHPERLFQELLRLAGQLMT
FSKGYVLADLPAYRHDDPGPGFARLDSILRELLETVISTRYFAITLEEVRPSFHVGRLDSGKIDDKTAFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLAYTPQVPPAIPVRPGACYFALDARSPLYE
RMLQAQSAMIYAPSGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|403516668|ref|NC_018527.1|:3593774-3595120 Burkholderia pseudomallei BPC006 chromosome I, complete sequence
ATGAGTTATTCGGCCAAGGTGCTCTGGGGAGAAGGCCTCTTTCTGAGGCCGCAGCACTTTCAGCGGCAGG
ACGCGTATCACGAAGCGCGCCTGTTCGAATCGATCCAGGCGATCCAGCCGTACAACTGGGGCGTGCGTTC
GGTGCGGTTCGATCGCGACGCGCTCGGCAGCAACGTGCTGCGCGCGAGCGAACTGTCGCTCGTGTTTCCG
GACGGCGCGCTCTACTCCGCGCCGCAAGCCGACGAACTGCCGCCGCCCATCGCGCTCGACACGCTGCCCG
AAGGCATCAACGAATTCACGTTCTACCTCGCGCTGCACCCGCTGCGCGAGACCGGCTCGAACTACGCGGA
CGACCGCGACGCCGGCTTCGTGTCGCGCTTCGTCAGCGAACAGGCGAGCGTTGCCGATCACTTCACCGAC
GCCGCGGAAGCGGACATCACGTTCCTGAAGACGAACGTGAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGTTGCTGTCGATCCCGCTCGTACGCGTGCGCCGCACCGCGACGTCCGGCTTCGAGATCGACGACGGCTT
CGTGCCGCCGTGCCTCGCGATCGAGGCGTCGCCGATCCTGCATCAGCGCCTGCGCCAGTTGATCGACGCG
CTGCAGGCGAAGGTGAATGCACTGTACGGTTTCCATCGCGAGCCGACGAAGAACATCATCGAGTTCCGCT
CGGGCGACATCGCATCGTTCTGGCTGCTGCACACGGCGAGCGCCGCGTTCGCCGCGCTCGCGCACCTGCA
CCAGCATTCGGCCTTGCATCCGGAGCGGCTGTTCCAGGAACTACTGCGCCTCGCGGGCCAGTTGATGACG
TTCTCGAAGGGCTACGTGCTCGCCGATCTGCCCGCGTACCGGCATGACGATCCGGGCCCGGGCTTCGCGC
GGCTCGATTCGATCCTGCGCGAGCTGCTCGAGACCGTGATCTCGACGCGCTACTTCGCGATCACGCTCGA
GGAAGTGCGGCCGTCGTTCCATGTCGGGCGGCTCGACTCGGGCAAGATCGACGACAAGACCGCGTTCTAT
CTCGCGGTGTCGGCCGACATGCCGTCGGTCGAACTCGTCGATGCGGTGCCCGCGCGCTTCAAGGTGGGCG
CGCCGGACGACGTCGACAAGCTCGTGCTCTCCGCGATGCCGGGCGTGCGCCTCGCGTACACGCCGCAGGT
GCCGCCCGCGATTCCCGTGCGCCCGGGCGCATGCTATTTCGCACTCGATGCGCGCAGCCCGCTCTATGAG
CGGATGCTGCAGGCCCAGTCGGCGATGATCTATGCGCCGTCCGGAATCAACGATCTCAAATTCGAACTGA
TCGCCGTCACGTCATGA