SecReT6
Protein ID: 403520335
SecReT6 ID693
T6SS typei4b
Gene symbol-
Locus tagBPC006_I3720
StrainBurkholderia pseudomallei BPC006
Repliconchromosome I [GenBank: NC_018527] [Browse all T6SS(s) in this replicon]
Location [Strand]3595117..3595902 [+]
Producthypothetical protein
NoteTssL
UniProt IDK7Q4M3
KEGG IDbpq:BPC006_I3720
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.00E-57, Aligned region: 31..232
Protein Sequence: 261 a.a.     [Download]
>gi|403520335|ref|YP_006654469.1| hypothetical protein BPC006_I3720 [Burkholderia pseudomallei BPC006]
MSYAPSLFGGNTPPPAPQTASSTDAGFQARSLVDLLYDGFFMLFLLKNGREPNDASEFGTRIQEFLSEFE
RGAKKLNIAADDVYAAKFAFCAAIDESVLSSPFKIRADWERRPLQLVLFGEQLAGEKFYQYLEECRAQGA
ARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIANMKGKRAPFAPHWPLPDQISHRLKREVPL
WAIGAVFALVGLLAFVGLNTYLKDSTVRALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 786 bp     [Download]
>gi|403516668|ref|NC_018527.1|:3595117-3595902 Burkholderia pseudomallei BPC006 chromosome I, complete sequence
ATGAGTTACGCGCCCTCCCTCTTCGGCGGCAACACGCCGCCCCCCGCGCCGCAAACGGCTTCGTCGACCG
ACGCCGGCTTCCAGGCGCGCTCGCTCGTCGATCTGCTGTACGACGGCTTCTTCATGCTGTTCCTGCTGAA
GAACGGCCGCGAGCCGAACGACGCGTCGGAATTCGGCACGCGCATTCAGGAATTCCTGAGCGAGTTCGAA
CGCGGCGCGAAGAAGCTCAACATCGCCGCCGACGACGTCTATGCGGCGAAGTTCGCGTTTTGCGCGGCGA
TCGACGAATCGGTGCTGTCGTCGCCGTTCAAGATCCGCGCGGACTGGGAGCGCCGGCCGTTGCAGCTCGT
GCTGTTCGGCGAGCAACTCGCGGGCGAGAAGTTCTATCAGTACCTCGAAGAATGCCGCGCACAGGGCGCG
GCGCGGCTGCAGTCGCTCGAGGTGTTCCATATGTGCCTGCTGCTCGGCTTCCAGGGCAAGTATCTGCTCG
AAGGGCCGGAAAAGCTCGCGTATCTGACCGCACGGCTTGGCGACGAGATCGCGAACATGAAGGGCAAGCG
CGCACCGTTCGCGCCGCATTGGCCGCTGCCGGACCAGATCTCGCACCGGCTCAAGCGCGAGGTGCCGCTG
TGGGCGATCGGAGCGGTGTTCGCGCTCGTCGGGCTGCTGGCGTTCGTCGGGCTGAATACGTATTTGAAAG
ACAGCACCGTGCGGGCGCTCGCGCCTTATTCGCAAGTCATCAAGGTGGGGCCGGAGTCGGCTAATTTGAC
GATTTCGTTGCCTTGA