SecReT6
Protein ID: 403521520
SecReT6 ID695
T6SS typei3
Gene symbol-
Locus tagBPC006_II0227
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]225524..226870 [-]
Producthypothetical protein
NoteTssK
UniProt IDK7Q6B2
KEGG IDbpq:BPC006_II0227
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.30E-144, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|403521520|ref|YP_006657089.1| hypothetical protein BPC006_II0227 [Burkholderia pseudomallei BPC006]
MSWHNKVVWSEGLFMRPQLFQQQERYLEHYAHKRAAPLSPFFFGFSHFSLDSEAPALGKIIVKSASGVFA
DGTPFDAPGSTPPPAPLTIRPEHLDQVIYLAVPIRVPNGEETAFDRAAESLARYAVFETDLRDTNSIGQG
PKTVQLSNLRLRLLPEKELTDAWIGLALTRVKTIRADASIELDDMLIPPVVGYGASDTLASWLAKIHDLT
RLRANALAERLTGSDGRAGTTAEVSDYLLLQTLNRYEPLLKHLQRVPTTSPAELYALLIGMAGELSTYVR
TDTRRPLDTHPPYQHVAPHLCLKPVVDDTHRLLNAVLVRSAQRLALADLGHGMLNAVVDPVDMQGFTAVV
LAVHAQMPPDLLQQQFAAQAKAGPSERLPDLVRSHLSGIALQTLPVPPRQIPFNAGYVYYELARGGPLWD
EVAQHGGLALHIAGEFPSLKLELWGIRG
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c226870-225524 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGAGCTGGCATAACAAGGTCGTCTGGAGCGAGGGGCTTTTCATGCGCCCGCAGCTGTTCCAGCAGCAGG
AGCGCTATCTCGAGCACTACGCGCACAAGCGCGCGGCGCCGCTGTCGCCGTTCTTCTTCGGCTTCAGCCA
CTTCAGCCTCGACAGCGAGGCGCCGGCGCTCGGCAAGATCATCGTGAAATCGGCGAGCGGCGTGTTCGCC
GACGGCACGCCGTTCGACGCGCCGGGCAGCACGCCGCCGCCCGCGCCGCTCACGATCCGGCCCGAGCATC
TGGACCAGGTGATCTACCTCGCGGTGCCGATCCGCGTGCCGAACGGCGAGGAAACCGCATTCGACCGCGC
GGCCGAATCGCTCGCGCGCTATGCCGTGTTCGAAACCGACCTGCGCGACACGAACTCGATCGGGCAAGGG
CCGAAGACGGTCCAGTTGTCGAACCTGCGCCTGCGGCTGCTTCCGGAAAAGGAACTGACGGACGCGTGGA
TCGGGCTCGCGCTCACGCGCGTGAAGACGATTCGCGCGGACGCGAGCATCGAGCTCGACGACATGCTGAT
TCCGCCCGTGGTCGGCTACGGCGCGAGCGACACGCTCGCGAGCTGGCTCGCGAAGATCCACGATCTCACG
CGCCTGCGCGCGAACGCGCTCGCCGAGCGCCTGACGGGCTCGGACGGCCGGGCGGGCACGACGGCCGAAG
TATCCGACTACCTGCTGCTGCAAACGCTCAATCGCTACGAGCCGCTGCTGAAACACCTGCAGCGCGTGCC
CACGACGTCGCCCGCCGAGCTGTACGCGCTGCTCATCGGCATGGCGGGCGAGCTGTCCACCTACGTGCGC
ACCGATACGCGCCGGCCGCTCGATACGCACCCGCCCTATCAGCACGTCGCGCCGCATCTGTGCCTGAAGC
CCGTCGTCGACGACACGCACCGGCTGCTCAACGCCGTGCTCGTGCGCAGCGCGCAGCGCCTCGCGCTCGC
CGATCTGGGGCACGGAATGCTCAACGCGGTCGTCGATCCGGTCGACATGCAGGGCTTCACCGCGGTCGTG
CTCGCGGTGCATGCGCAGATGCCGCCCGATCTGCTGCAGCAGCAGTTCGCCGCGCAGGCGAAGGCGGGGC
CGTCCGAGCGGCTGCCGGACCTCGTGCGCAGCCATCTGTCCGGCATCGCGCTGCAGACGCTGCCGGTGCC
GCCCCGGCAGATCCCGTTCAACGCCGGCTACGTCTATTACGAGCTCGCGCGCGGCGGGCCGCTGTGGGAC
GAAGTCGCGCAGCACGGCGGGCTCGCGCTGCACATCGCCGGCGAATTTCCGTCGCTGAAGCTCGAGCTAT
GGGGCATTCGCGGATAG