SecReT6
Protein ID: 403521522
SecReT6 ID695
T6SS typei3
Gene symbol-
Locus tagBPC006_II0229
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]227502..227987 [-]
ProductSciM protein
NoteTssD
UniProt IDK7PWU4
KEGG IDbpq:BPC006_II0229
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.40E-44, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|403521522|ref|YP_006657091.1| SciM protein [Burkholderia pseudomallei BPC006]
MAQDIFLKIDGINGESLDDSHKDEIEVLNWNWEIQQESTMHTGSGGGAGKASVKDLTFEHAIDRASPNLM
KYALTGKHVDQAVLVMRKAGGNPLEYLKLTMSDVIITRVRPSGSRDDTERSRETVSLSFAKVKQEYVVQN
AQGGSGGAVTTSFDIKGNKEA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c227987-227502 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGGCGCAGGATATTTTTCTGAAGATCGACGGCATCAACGGTGAATCCCTCGACGACAGCCACAAGGACG
AGATCGAAGTCCTGAACTGGAACTGGGAGATTCAGCAGGAATCGACGATGCACACGGGCAGCGGCGGCGG
CGCCGGCAAGGCGAGCGTGAAGGATCTGACGTTCGAGCACGCGATCGACCGCGCGAGCCCCAACCTGATG
AAGTACGCGCTGACCGGCAAGCACGTCGATCAGGCGGTGCTCGTGATGCGCAAGGCGGGCGGCAATCCGC
TCGAATACCTGAAGCTCACGATGAGCGACGTGATCATCACGCGCGTGCGGCCGTCGGGCAGCCGCGACGA
CACCGAGCGCAGCCGCGAGACGGTATCGCTGTCGTTCGCGAAGGTGAAGCAGGAGTATGTCGTGCAGAAC
GCGCAGGGCGGCAGCGGCGGCGCCGTCACGACGAGCTTCGACATCAAGGGCAACAAGGAAGCCTGA