SecReT6
Protein ID: 403521523
SecReT6 ID695
T6SS typei3
Gene symbol-
Locus tagBPC006_II0230
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]228104..229603 [-]
Producthypothetical protein
NoteTssC
UniProt IDK7QAQ1
KEGG IDbpq:BPC006_II0230
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.00E-192, Aligned region: 67..493
Protein Sequence: 499 a.a.     [Download]
>gi|403521523|ref|YP_006657092.1| hypothetical protein BPC006_II0230 [Burkholderia pseudomallei BPC006]
MKKQQAQTAAAGVQPQADSDFAQLLAQEFKPKTEQAREAVEYAVRTLAEQALAQSATISDDAYKSIAAII
AQIDHKLSEQINLILHHADFQKLESAWRGLHHLVSNTETDERLKIRFMDISKEELRRTMRRYKGQSWDQS
PLFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLGSISKVAASAHTPFISGASPSVLQMESWQELA
NPRDLTKIFTQNLEYASWNALRNMDDARYIGLAMPRFLSRLPYGVLTNPVDEFDFEEDTNGADHRRYAWT
NAAYAMGVNINRSFRLYGWCSLIRGVESGGTVENLPCHTFPTDDGGIDIKCPTEIAISDRREAELSKNGF
IPLVHRKNTDHATFIGAQSLHKPAEYDDSDATANANLSARLPYLFACSRFAHYLKCIVRDKVGAFKERED
MQRWLNEWIMNYVDADPANSSQDTKARRPLAAAEVVVEQAQGNPGYYQAKFFLRPHFQLEGLTVSLRLVA
KLPSIKEAA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c229603-228104 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGAAGAAACAGCAAGCCCAGACGGCCGCCGCCGGCGTCCAGCCGCAAGCGGATTCGGATTTCGCGCAGT
TGCTCGCGCAGGAGTTCAAGCCGAAGACGGAGCAGGCGCGCGAAGCGGTCGAATACGCGGTGCGCACGCT
CGCCGAGCAGGCGCTCGCGCAATCGGCGACGATCAGCGACGATGCATACAAGAGCATCGCCGCGATCATC
GCGCAGATCGACCATAAGCTATCCGAACAGATCAACCTGATCCTCCATCACGCGGATTTCCAGAAGCTCG
AATCGGCGTGGCGCGGGCTGCATCACCTGGTGTCGAACACCGAGACCGACGAGCGTCTGAAGATCCGCTT
CATGGACATCTCGAAGGAAGAGCTGCGCCGCACGATGCGGCGCTACAAGGGACAATCGTGGGACCAGAGC
CCGCTCTTCAAGCAGATCTACGAGGAGGAGTACGGGCAGCTCGGCGGCGAGCCGTACGGCTGCCTCGTCG
CCGATTACTACTTCGACCACACGCCGCCCGACGTCGACCTGCTCGGCTCGATCTCGAAGGTGGCCGCGTC
CGCGCACACGCCGTTCATCTCCGGCGCGTCGCCTTCGGTGCTGCAGATGGAATCGTGGCAGGAGCTCGCG
AACCCGCGCGACCTGACGAAGATCTTCACGCAAAACCTCGAATACGCGTCATGGAACGCGCTGCGCAACA
TGGACGACGCGCGCTACATCGGCCTCGCGATGCCGCGCTTCCTGTCGCGCCTGCCGTACGGCGTGCTGAC
GAATCCCGTCGACGAGTTCGACTTCGAGGAAGACACGAACGGCGCCGACCATCGCCGCTACGCGTGGACG
AACGCCGCCTACGCGATGGGCGTGAACATCAACCGGTCGTTCCGGCTCTACGGCTGGTGCTCGCTCATTC
GCGGCGTCGAATCGGGCGGCACGGTCGAGAACCTGCCGTGCCATACGTTCCCGACCGACGACGGCGGCAT
CGACATCAAATGCCCAACCGAGATCGCGATCTCGGACCGGCGCGAGGCGGAGCTGTCGAAGAACGGCTTC
ATTCCGCTCGTGCACCGCAAGAACACCGATCACGCGACGTTCATCGGCGCGCAATCGCTGCACAAGCCGG
CCGAATACGACGATTCCGACGCGACGGCCAACGCGAATCTGTCGGCGCGCCTGCCGTATCTGTTCGCATG
CTCGCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGGTGGGCGCCTTCAAGGAGCGCGAGGAC
ATGCAGCGCTGGCTGAACGAATGGATCATGAACTACGTCGACGCGGACCCGGCGAACTCGTCGCAGGACA
CGAAGGCGCGCCGGCCGCTCGCGGCCGCCGAGGTGGTCGTCGAGCAGGCGCAGGGCAACCCCGGCTACTA
CCAGGCGAAGTTCTTCCTGCGGCCGCATTTCCAGCTCGAGGGCCTGACCGTGTCGCTGCGGCTCGTCGCG
AAGCTGCCGTCGATCAAGGAAGCCGCCTGA