SecReT6
Protein ID: 403521524
SecReT6 ID695
T6SS typei3
Gene symbol-
Locus tagBPC006_II0231
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]229638..230219 [-]
Producthypothetical protein
NoteTssB
UniProt IDK7PXU2
KEGG IDbpq:BPC006_II0231
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.90E-59, Aligned region: 11..164
Protein Sequence: 193 a.a.     [Download]
>gi|403521524|ref|YP_006657093.1| hypothetical protein BPC006_II0231 [Burkholderia pseudomallei BPC006]
MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKPVAPLPAVADRRFLDIDIDNF
DERMKAIKPRVAFAVDNTLSGDGQLMVDMTFESIEDFSPAAIARMVGPLRQLLEARTQLANLQTYMDGKS
GAETLVNQLLQDPALLRSLAAAPKPQLAGGPDAGNARGAKDAPDTANHDSDAA
 
Nucleotide Sequence: 582 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c230219-229638 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGTCCGCATCCAGCAGCTCTCAAAAATTCATCGCGCGCAACCGCGCGCCCCGCGTGCAGATCGAATACG
ACGTCGAAGTCTACGGCTCGGAAAAGAAGGTCGAACTGCCGTTCGTGATGGGCGTGCTCGCCGACCTGTC
GGGCAAGCCGGTCGCGCCGCTGCCCGCCGTCGCCGACCGGCGCTTCCTCGACATCGACATCGACAACTTC
GACGAGCGGATGAAGGCGATCAAGCCGCGCGTGGCGTTCGCGGTGGACAACACGCTGTCGGGCGACGGGC
AGCTGATGGTCGACATGACGTTCGAAAGCATCGAGGACTTCTCGCCCGCCGCGATCGCGCGAATGGTCGG
CCCGTTGCGGCAATTGCTCGAGGCGCGCACGCAGCTCGCGAACCTGCAGACCTACATGGACGGCAAGTCG
GGCGCCGAGACGCTCGTCAACCAGTTGCTGCAGGACCCGGCGCTGCTGCGCTCGCTCGCGGCCGCGCCGA
AGCCGCAGCTCGCGGGCGGGCCGGACGCGGGCAATGCGCGCGGCGCGAAGGACGCGCCCGACACGGCGAA
CCACGACAGCGATGCGGCCTGA