SecReT6
Protein ID: 403521527
SecReT6 ID695
T6SS typei3
Gene symbol-
Locus tagBPC006_II0234
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]234445..235410 [+]
ProductImpE/SciE family protein
NoteTagJ
UniProt IDK7PWU7
KEGG IDbpq:BPC006_II0234
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.80E-51, Aligned region: 149..294
Protein Sequence: 321 a.a.     [Download]
>gi|403521527|ref|YP_006657096.1| ImpE/SciE family protein [Burkholderia pseudomallei BPC006]
MTTPAFPAPPGARTSARPHDTPLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQWERAVGQLQAYARF
AAQHAHIAHAYRDLIRAERFRARVMAGHARPGFVFDAPPWIDDLREALRAQAAGARDEADRARSRALDRA
PFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFADLAGWRLARPGVPLDLVWAPCVLTLADGSV
AHGFMPARYPGSELADGSGAPGASAAAHEADAHESAVREADALRLGSRTAWRDVGRTGVFALGRKTWSTS
AGDAGLFELHACEFGARARAGAVLGGAAREARGGEAADGCA
 
Nucleotide Sequence: 966 bp     [Download]
>gi|403521294|ref|NC_018529.1|:234445-235410 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGACGACGCCCGCCTTCCCGGCGCCGCCCGGCGCGCGCACGTCGGCCCGGCCGCACGATACGCCGCTCG
ACGCGCGGCTCGCGGCTGCGCAAGCCGCGGTGCGCGCCCGGCCCGTCGATGCGGCGAGCCGTTGGGCGCT
GTTTCAACTGCTCTGCGTGACGGGCCAGTGGGAACGCGCCGTCGGGCAGTTGCAGGCTTATGCGCGGTTC
GCCGCGCAGCACGCGCACATCGCGCACGCCTATCGCGACCTGATTCGCGCCGAGCGCTTTCGCGCCCGCG
TGATGGCGGGCCACGCGCGGCCGGGATTCGTATTCGATGCGCCGCCGTGGATCGACGATCTGCGGGAAGC
GTTGCGCGCGCAGGCGGCCGGCGCGCGCGACGAAGCCGACCGCGCGCGTTCGCGCGCGCTCGATCGCGCG
CCGTTCGTCGCGGGGCGCGGGCCGGATGCGCCGTTCGACTGGATCGCCGACAGCGATTCGCGATTCGGGC
CGGTCTGCGAAGTCGTGACCGCCGGGCATGATCGTTGGCTGCCGTTTGCGGATCTGGCCGGATGGCGGCT
CGCGCGCCCGGGCGTGCCGCTCGATCTGGTCTGGGCGCCGTGCGTGCTCACGCTTGCCGACGGCAGTGTC
GCGCACGGCTTCATGCCGGCGCGTTACCCGGGCTCCGAACTGGCCGACGGGAGCGGCGCGCCGGGCGCCT
CGGCGGCCGCGCACGAGGCCGATGCGCACGAGAGCGCCGTGCGCGAGGCCGATGCGTTGCGGCTCGGCAG
CCGGACCGCATGGCGCGACGTCGGCCGCACCGGCGTGTTCGCGCTCGGCCGCAAGACCTGGTCGACGAGC
GCGGGCGACGCCGGCCTTTTCGAGCTGCACGCGTGTGAATTCGGCGCGCGCGCCCGTGCGGGCGCCGTGC
TCGGCGGCGCGGCGCGCGAAGCGCGCGGCGGGGAGGCGGCCGATGGATGCGCATGA