SecReT6
Protein ID: 403521528
SecReT6 ID695
T6SS typei3
Gene symbol-
Locus tagBPC006_II0235
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]235397..235978 [+]
Producthypothetical protein
NoteTssE
UniProt IDK7QAQ3
KEGG IDbpq:BPC006_II0235
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.30E-18, Aligned region: 60..170
Protein Sequence: 193 a.a.     [Download]
>gi|403521528|ref|YP_006657097.1| hypothetical protein BPC006_II0235 [Burkholderia pseudomallei BPC006]
MDAHETRADAPRNGDEARVRGEGLATPRRANTQLLPTLIDRLRDDAPQRQTEAPGEYALTRMQMRGIVQR
DLAFLLNTTSIDEHIDRERHPAAAASTLNFGVPPLAGAFLASCQWAEVERIIRRVILDFEPRLIAETLVV
APSRAAGAVARPNVLAFEVRGMIRMDPYPIEFMVQSALDLETNQVNITGMRAS
 
Nucleotide Sequence: 582 bp     [Download]
>gi|403521294|ref|NC_018529.1|:235397-235978 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGGATGCGCATGAGACGCGCGCGGACGCGCCGCGCAACGGCGACGAGGCGCGCGTGCGCGGCGAAGGCC
TCGCGACGCCGCGCCGCGCGAACACGCAGCTGCTGCCGACGCTGATCGACCGCCTGCGCGACGACGCGCC
GCAACGGCAGACCGAAGCGCCCGGCGAATATGCGCTCACGCGCATGCAGATGCGCGGCATCGTCCAGCGT
GATCTCGCCTTCCTGCTCAACACGACGAGCATCGACGAGCACATCGATCGCGAACGCCATCCGGCCGCCG
CCGCCTCGACGCTCAACTTCGGCGTGCCGCCGCTTGCCGGCGCGTTTCTCGCGTCGTGCCAGTGGGCCGA
GGTCGAACGCATCATCCGCCGCGTAATTCTCGATTTCGAGCCGCGGCTGATCGCCGAGACGCTCGTCGTC
GCGCCGTCGCGGGCCGCCGGCGCGGTCGCGCGCCCGAACGTGCTCGCGTTCGAGGTGCGCGGCATGATTC
GTATGGATCCCTATCCGATCGAATTCATGGTGCAAAGCGCGCTCGATCTCGAAACGAACCAGGTCAACAT
CACCGGCATGCGCGCGAGCTGA