SecReT6
Protein ID: 403521530
SecReT6 ID695
T6SS typei3
Gene symbol-
Locus tagBPC006_II0237
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]237897..238982 [+]
Producthypothetical protein
NoteTssG
UniProt IDK7Q6B9
KEGG IDbpq:BPC006_II0237
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.30E-101, Aligned region: 24..325
Protein Sequence: 361 a.a.     [Download]
>gi|403521530|ref|YP_006657099.1| hypothetical protein BPC006_II0237 [Burkholderia pseudomallei BPC006]
MARDMTQAAVADTALSPQALARLRAEPWRYGFLALLRRIGADARIDPIGKARRPQAEPFRLGQQPSLAFA
PREIASVGDANGRLKVRLFGLGMLGPNGPLPIHVTEIARDREESRRDPTLGNFLDIFHHRYLTLLYRAWA
SAQAAAGLDRPDDERFSFYVASLAGQDLDEVGARPLPAHARLSASPHLVREARNADGLRMTLERYFGVPV
TLEENVFHWIAVDPLEHSRLGRPGDASTMAAGALLGELVPDRQHKFRLVFGPLDIDAYLRFTPRGEDLPR
LVEWVRAFVGYEFEWELELRIKPNGAPPAVMGGPHQLGWSGWLGRSPSGEPVTGMRFEPEHYAHGFARGT
ARDTRGMRGER
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|403521294|ref|NC_018529.1|:237897-238982 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGGCGCGCGACATGACGCAGGCGGCCGTTGCCGACACGGCGCTGTCGCCGCAAGCGCTCGCGCGGCTGC
GCGCCGAACCGTGGCGCTATGGGTTCCTCGCGCTGCTGCGCCGCATCGGCGCGGATGCGCGCATCGATCC
GATCGGCAAGGCGAGGCGCCCGCAGGCGGAGCCGTTTCGCCTCGGCCAGCAGCCGAGCCTCGCGTTCGCG
CCGCGCGAGATCGCCAGCGTCGGCGACGCGAACGGGCGGCTCAAGGTGCGGCTGTTCGGGCTCGGGATGC
TGGGGCCGAACGGGCCGCTGCCGATCCACGTGACGGAGATCGCGCGCGATCGCGAGGAGAGCCGGCGCGA
TCCGACGCTCGGCAATTTTCTCGACATCTTCCATCATCGCTATCTGACGCTGCTGTATCGCGCGTGGGCG
TCGGCGCAGGCGGCGGCCGGCCTCGATCGTCCGGACGACGAACGGTTTTCGTTCTACGTCGCGAGCCTCG
CCGGCCAGGATCTCGACGAGGTCGGCGCGCGGCCGCTGCCCGCGCACGCGCGGCTGTCCGCCTCGCCGCA
TCTGGTGCGCGAGGCGCGCAACGCGGACGGCCTGCGAATGACGCTCGAACGTTACTTCGGCGTGCCGGTG
ACGCTGGAGGAAAACGTATTTCACTGGATCGCCGTCGATCCGCTCGAGCACAGCCGGCTCGGCCGGCCCG
GCGACGCATCGACGATGGCCGCGGGCGCGCTGCTCGGCGAGCTGGTGCCGGATCGGCAGCACAAGTTCCG
GCTCGTGTTCGGGCCGCTCGACATCGACGCCTATCTGCGCTTCACGCCGCGGGGCGAGGATCTGCCGCGG
CTCGTCGAATGGGTGCGGGCGTTCGTCGGCTACGAGTTCGAGTGGGAGCTCGAGTTGCGGATCAAGCCGA
ACGGCGCGCCGCCCGCCGTGATGGGCGGCCCGCATCAACTCGGCTGGTCGGGCTGGCTCGGCCGCTCGCC
GTCCGGCGAGCCGGTGACGGGCATGCGTTTCGAACCCGAGCACTATGCGCACGGGTTCGCGCGCGGCACG
GCTCGCGACACGCGCGGCATGCGAGGTGAACGATGA