SecReT6
Protein ID: 403521531
SecReT6 ID695
T6SS typei3
Gene symbol-
Locus tagBPC006_II0239
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]240166..242493 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDK7Q5M7
KEGG IDbpq:BPC006_II0239
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.10E-84, Aligned region: 36..362
Phage_GPD [PF05954], Evalue: 6.10E-84, Aligned region: 596..642
Phage_base_V [PF04717], Evalue: 1.50E-21, Aligned region: 299..316
Phage_base_V [PF04717], Evalue: 1.50E-21, Aligned region: 400..492
Protein Sequence: 775 a.a.     [Download]
>gi|403521531|ref|YP_006657100.1| Rhs element Vgr protein [Burkholderia pseudomallei BPC006]
MPNFSAARTVTVSGPAVPTTPVGEPALELSAIRGDETLSEIYSYTLDCLTPPDPLLAHERAANLDLKAMI
GKALTVTVQLEGMGSFVPGMPGMAGAANIGAGAREISGIVTGARFEGQLNRQCRYRLTMRPWIYLADLRS
DYRIFQNRSVDEIVDEVLNAYSYSYDKRLSGRYPKLGYQVQYGETDFAFIQRLMQEHGIYWFFEHTNQVH
RMVLVDHLGAHKPVESAAYRTLRYYPPGHKIDAEYIDRFSTEEHIRPGRWATGDFDFEKPNADLGVENAL
PRDTAHNGLERYEWPGDYTAREHGEHLARVRMEQTRARGERASGGGNVRDIVCGTTFALAGHPHASANRE
YLVIGATFEATETGGASGPGAYRIDTSFVAQPATTAFRPPRTVRKPRTRGPQTAIVTGPRGQDIWTDQYG
RVKLKFHWDRSLVDDQNSSCWVRVSYAWSGNNYGGVNIPRVGSEVVVDFEHGDPDRPLVTGQVYNALHMP
PWPLPENATQSGFMTRSPAGGGENANMLRFEDKAGEEQVKLHAERNYDVSVERDATTAVGRKHLTLVGVD
LMPVMSTRSPLERLIDLLRTGGAASPAASGQPAAASRQPSGQQQQHQQQHQQHQRQHQPYQQLKQQRQMQ
RAGGWQALAANVAKTLQEIVAVLTDPFVTASVSTVQGASTSVVFGDAKGVHVGDTVKITSGDAHSEVNGT
ASSKDVNSVSLKGTSTSLTGVSTSETGTNIVTTGLTVSTTGASVSTTGFSATETLVQVAKKTQECEFIKG
IKISM
 
Nucleotide Sequence: 2328 bp     [Download]
>gi|403521294|ref|NC_018529.1|:240166-242493 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGCCGAATTTTTCCGCCGCCCGCACCGTGACGGTGAGCGGCCCTGCCGTGCCGACGACGCCCGTCGGCG
AGCCCGCGCTCGAACTGAGCGCGATCCGGGGCGACGAAACGCTATCGGAGATCTATTCGTACACGCTCGA
TTGCCTGACGCCGCCGGACCCGTTGCTCGCGCACGAGCGGGCCGCGAATCTCGATCTGAAGGCGATGATC
GGCAAGGCGCTGACCGTGACCGTGCAGCTCGAAGGCATGGGCTCGTTCGTGCCCGGCATGCCGGGCATGG
CGGGCGCGGCCAATATCGGCGCGGGCGCGCGCGAGATCAGCGGCATCGTGACCGGCGCGCGCTTCGAGGG
CCAACTGAACCGGCAGTGCCGCTACCGGCTGACGATGCGGCCGTGGATCTACCTGGCCGACCTGCGCTCG
GACTACCGGATTTTCCAGAACCGGAGCGTCGACGAGATCGTCGACGAAGTGCTGAACGCGTATTCGTACT
CGTACGACAAGCGCTTGAGCGGCCGGTATCCGAAGCTCGGCTACCAGGTGCAGTACGGCGAGACCGATTT
CGCGTTCATCCAGCGGCTGATGCAGGAGCACGGCATCTACTGGTTTTTCGAGCATACGAACCAGGTGCAC
CGGATGGTGCTCGTCGATCACCTGGGCGCGCACAAGCCGGTGGAGAGCGCCGCATACCGCACGCTGCGCT
ACTACCCGCCGGGGCACAAGATCGACGCCGAGTACATCGACAGGTTCAGCACCGAGGAGCACATCCGGCC
GGGCCGCTGGGCGACGGGCGATTTCGATTTCGAGAAGCCGAACGCGGACCTGGGCGTCGAGAACGCGCTG
CCGCGGGACACCGCGCACAACGGGCTCGAACGTTACGAGTGGCCGGGCGACTACACGGCGCGCGAGCACG
GCGAGCACCTCGCGCGCGTGCGCATGGAACAGACGCGCGCGCGGGGCGAGCGCGCATCGGGCGGCGGCAA
CGTGCGCGACATCGTGTGCGGCACGACATTCGCGCTCGCGGGCCATCCGCACGCGAGCGCGAACCGCGAG
TATCTGGTGATCGGCGCGACGTTCGAGGCGACGGAGACGGGCGGCGCGTCGGGGCCGGGCGCATATCGGA
TCGACACGTCGTTCGTCGCGCAGCCGGCGACCACCGCGTTCCGGCCGCCGCGCACGGTGCGCAAGCCGCG
CACGCGCGGGCCGCAGACGGCGATCGTCACCGGCCCGCGAGGGCAGGACATCTGGACGGACCAGTACGGC
CGTGTGAAGCTGAAATTCCACTGGGACCGTTCGCTCGTCGACGATCAGAACTCGTCGTGCTGGGTGCGCG
TTTCCTATGCGTGGTCGGGCAACAATTACGGCGGCGTCAATATTCCGCGCGTGGGCTCCGAAGTGGTCGT
CGATTTCGAGCACGGCGACCCGGACCGGCCGCTCGTGACGGGGCAGGTATACAACGCGCTGCACATGCCG
CCGTGGCCGTTGCCGGAGAACGCGACGCAAAGCGGCTTCATGACGCGCTCGCCCGCGGGCGGCGGCGAGA
ACGCGAACATGCTGCGCTTCGAGGACAAGGCGGGCGAGGAGCAGGTCAAGCTGCATGCGGAGCGCAATTA
CGACGTATCGGTCGAGCGCGACGCGACGACTGCCGTCGGGCGCAAGCACCTGACGCTCGTCGGCGTCGAC
CTGATGCCGGTGATGTCGACGCGCTCGCCGCTGGAGCGGCTGATCGACCTGCTGCGCACGGGCGGCGCGG
CCAGCCCGGCGGCGTCGGGGCAGCCGGCGGCGGCTTCCCGGCAACCGTCGGGACAGCAGCAGCAACATCA
ACAGCAACACCAGCAACATCAGCGGCAACACCAGCCCTATCAGCAGTTGAAGCAGCAGCGCCAGATGCAG
CGCGCGGGCGGATGGCAGGCGCTCGCGGCGAACGTCGCGAAGACGTTGCAGGAAATCGTGGCGGTGCTCA
CGGACCCGTTCGTCACCGCGTCGGTGAGCACCGTGCAGGGCGCGTCGACGTCCGTCGTGTTCGGCGACGC
GAAGGGCGTGCACGTGGGCGATACCGTCAAGATCACCAGCGGAGACGCGCATTCGGAGGTCAACGGCACG
GCATCGTCGAAGGACGTGAACAGTGTCTCGCTGAAGGGCACGTCGACCAGCCTGACCGGGGTCAGCACCT
CCGAAACGGGGACGAACATCGTGACGACCGGACTCACGGTATCAACGACCGGCGCGAGCGTTTCGACGAC
CGGATTCAGTGCGACCGAAACGCTCGTGCAGGTCGCCAAGAAGACGCAGGAATGCGAATTCATCAAGGGC
ATCAAGATCTCGATGTGA