SecReT6
Protein ID: 403522029
SecReT6 ID696
T6SS typei3
Gene symbol-
Locus tagBPC006_II0744
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]739446..740003 [+]
Producthypothetical protein
NoteTssB
UniProt IDK7PYY0
KEGG IDbpq:BPC006_II0744
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-54, Aligned region: 14..162
Protein Sequence: 185 a.a.     [Download]
>gi|403522029|ref|YP_006657598.1| hypothetical protein BPC006_II0744 [Burkholderia pseudomallei BPC006]
MLIMVRQKDGQKFIGESRAPRVQIEYDVEVYGSQKKVELPFVAGVMADLSGDNVEPLGPVEDRRFQEIDV
ENFDERMAQIAPSLSYHVKNVLTNDGTLIPIDLTFTSMESFEPADVVKRIPELSTLLEARNRLKELLTYM
DGKAAAEDVIQELLKSPQWANEADAAEQSGGAGEGGDHQPEEGAK
 
Nucleotide Sequence: 558 bp     [Download]
>gi|403521294|ref|NC_018529.1|:739446-740003 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
TTGCTCATCATGGTTCGACAAAAGGATGGACAGAAATTCATCGGGGAGAGTCGTGCGCCCCGCGTGCAGA
TTGAATACGACGTGGAGGTGTACGGCTCGCAGAAGAAGGTCGAGCTGCCGTTCGTCGCGGGCGTGATGGC
GGACCTGTCGGGCGACAACGTCGAGCCGCTCGGCCCGGTCGAGGATCGGCGCTTTCAGGAGATCGACGTC
GAGAACTTCGATGAGCGCATGGCGCAGATCGCGCCGTCGCTGAGCTATCACGTGAAGAACGTGCTGACCA
ACGACGGCACGCTGATTCCGATCGATCTGACGTTCACGTCGATGGAATCGTTCGAGCCGGCGGACGTCGT
CAAGCGCATTCCCGAGCTGTCGACGCTGCTCGAGGCGCGCAACCGGCTGAAGGAGCTGCTGACCTACATG
GACGGCAAGGCGGCGGCCGAGGACGTGATCCAGGAATTGTTGAAGAGCCCGCAGTGGGCGAACGAGGCCG
ACGCGGCGGAGCAATCCGGCGGCGCCGGCGAGGGTGGAGACCATCAACCGGAAGAGGGTGCGAAATGA