SecReT6
Protein ID: 403522031
SecReT6 ID696
T6SS typei3
Gene symbol-
Locus tagBPC006_II0746
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]741655..742182 [+]
Producthypothetical protein
NoteTssD
UniProt IDK7Q6I5
KEGG IDbpq:BPC006_II0746
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-32, Aligned region: 9..150
Protein Sequence: 175 a.a.     [Download]
>gi|403522031|ref|YP_006657600.1| hypothetical protein BPC006_II0746 [Burkholderia pseudomallei BPC006]
MANALVDYFLQIDGVEGESTDQQYPGLIQIQSWQWAEENSGRWGFGSGGGAGKVEMKDFEFRMVSNKASP
KLFLMCATGEHIQNAKLICRKSGKGQQEFLTISFASGLVSSFRTLGNMPISQLGHASGEVDGVLPTDQIR
INFAQIEFEYREQRNDGTMGAVIKAGYDLKQNAPI
 
Nucleotide Sequence: 528 bp     [Download]
>gi|403521294|ref|NC_018529.1|:741655-742182 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGGCAAATGCTTTGGTTGATTACTTCTTGCAGATCGATGGCGTCGAGGGTGAGTCGACCGATCAGCAAT
ATCCCGGTCTGATCCAGATCCAGAGCTGGCAGTGGGCGGAAGAGAACTCGGGCCGCTGGGGCTTCGGCAG
CGGCGGCGGCGCGGGCAAGGTCGAGATGAAGGACTTCGAGTTCCGCATGGTGTCGAACAAGGCGTCGCCG
AAGCTGTTCCTGATGTGCGCGACGGGTGAGCACATCCAGAACGCGAAGCTGATCTGCCGCAAGTCGGGCA
AGGGCCAGCAGGAGTTCCTGACGATCTCGTTCGCGAGCGGCCTCGTGTCGTCGTTCCGCACGCTCGGCAA
CATGCCGATCTCGCAGCTCGGTCACGCGAGCGGCGAAGTCGACGGCGTGCTGCCGACGGATCAGATCCGC
ATCAACTTCGCCCAGATCGAGTTCGAGTACCGCGAGCAGCGCAACGACGGCACGATGGGCGCCGTGATCA
AGGCGGGCTACGACCTGAAGCAGAACGCGCCGATCTAA