SecReT6
Protein ID: 403522036
SecReT6 ID696
T6SS typei3
Gene symbol-
Locus tagBPC006_II0751
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]748464..750710 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDK7Q6I8
KEGG IDbpq:BPC006_II0751
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.30E-71, Aligned region: 8..313
Phage_GPD [PF05954], Evalue: 8.30E-71, Aligned region: 676..702
Phage_base_V [PF04717], Evalue: 3.50E-23, Aligned region: 351..444
Protein Sequence: 748 a.a.     [Download]
>gi|403522036|ref|YP_006657605.1| Rhs element Vgr protein [Burkholderia pseudomallei BPC006]
MALSFVVHENLSQEPSYQLDLLSHDPDLDFDALLGSTLSADIDLGEGDIRTFNTHVFGGYDTGQMSGQYT
YTLELRSWLSFLAENRNSRIFQNMSVPQIVEQVFQGHQRNGYRFELEGTYEPREYCVQFQETDLNFVKRL
LEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYLPDGEESRAIQGREGVQRLQRTRRIKSNNVA
LRDFDYHAPSNKLDSDAQQVSPPNLEGIPLEYYDYAAGYREPEQGERLARLRLEAIQAESHTLVGEANAR
ALATGRAFTLIGHPALGRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALVDDQPFRPLLTTPRPEVP
GIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVSQAWAGKGWGVIAMPRVGQEVLVTY
VDGDLDRPLVTGIVYNGENPTPYDLPKDIRYTGLVSRSIKRAGGYQNASQITFDDQRGAERVMIHAERDM
QQTVERNSSTSIAQDLNLSVKGTSTSVVGISISFTGISVSYTGLSVSFTGVSASFTGVSTSFTGVSTSFT
GVSTSFTGVDTGFKGVSTSFTGVDTSFKGVSTSFTGVSTSLTGSSNSVTGVSNSMTGISSSWTDVSMSTT
GQSQSITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMSTTGSSTSVTGSSVSTT
GSSVSTTGSSVSTTGSSVSTTGFSFSYTGVSYSDTGIDLKKVGMQVKS
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|403521294|ref|NC_018529.1|:748464-750710 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
GTGGCGCTGAGCTTCGTGGTGCACGAGAACCTGTCGCAGGAGCCGTCGTATCAACTGGATCTGCTGAGCC
ACGATCCGGATCTGGACTTCGACGCGCTGCTCGGCTCGACGCTGTCGGCCGACATCGACCTGGGCGAAGG
CGACATCCGGACGTTCAACACGCACGTGTTCGGCGGCTACGACACGGGGCAGATGAGCGGGCAATACACG
TACACGCTGGAGCTGCGAAGCTGGCTGTCGTTTCTCGCGGAGAACCGCAACAGCCGGATCTTCCAGAACA
TGAGCGTGCCGCAGATCGTCGAGCAGGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAGCTCGA
AGGCACGTACGAGCCGCGCGAGTACTGCGTGCAGTTCCAGGAAACGGATCTGAACTTCGTGAAGCGGCTG
CTGGAGGACGAAGGGATCTACTTCTGGGTGGAGCACGAGCCGGATCGTCATGTGGTGGTGATCTCGGACA
CGCAGCGGTTCGAGGATCTGCCGCTGCCGAACGACACGCTGGAGTATCTGCCGGACGGCGAGGAGTCGCG
CGCGATCCAGGGGCGCGAAGGGGTGCAGCGGCTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTCGCG
CTGCGGGATTTCGACTATCACGCGCCGTCGAACAAGCTCGATAGCGACGCGCAGCAGGTGTCGCCGCCGA
ACCTCGAAGGGATTCCGCTCGAGTATTACGACTATGCGGCGGGCTACCGCGAGCCCGAGCAGGGCGAGCG
TCTCGCGCGGCTGCGGCTCGAGGCGATTCAGGCGGAGTCACACACGCTGGTGGGCGAGGCGAACGCGCGC
GCGCTGGCCACGGGCCGGGCGTTCACGTTGATCGGGCATCCGGCGCTGGGGCGCAATCGTCGGTACTACG
TGACGAACAGCGAGCTGACGTTCATCCAGGACGGACCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGT
GAAGTTCCGCGCGCTTGTCGACGATCAGCCGTTTCGGCCGCTGTTGACGACGCCGCGTCCCGAAGTGCCG
GGCATCCAGAGCGCGACGGTGGTGGGTCCGGAGATGTCGGAAGTGCATACCGACAAGCTCGGGCGGATTC
GCGTGCATTTCCATTGGGACCGCTACAAGACGACCGAGGCGGATGCGTCGTGCTGGATACGCGTGTCGCA
GGCATGGGCGGGCAAGGGCTGGGGCGTGATCGCGATGCCGCGGGTCGGGCAGGAAGTGCTCGTCACGTAT
GTCGACGGCGATCTCGATCGGCCGCTCGTGACGGGCATCGTCTACAACGGCGAGAACCCGACGCCTTATG
ACTTGCCGAAGGACATCCGCTACACGGGGCTGGTGTCGCGTTCGATCAAGCGTGCGGGCGGTTATCAGAA
CGCGAGTCAGATCACGTTCGATGACCAGCGCGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACATG
CAGCAGACGGTCGAGCGCAACAGCTCGACGTCGATCGCGCAGGATTTGAACCTGTCGGTGAAGGGCACGT
CGACGTCGGTCGTCGGCATCTCGATCAGCTTCACGGGCATCTCGGTGTCGTACACGGGGTTGTCGGTGAG
CTTCACCGGCGTGTCGGCGAGCTTCACGGGCGTGAGCACGTCGTTTACCGGCGTGAGCACGAGTTTCACC
GGCGTGTCGACGTCGTTTACCGGCGTCGACACCGGCTTCAAGGGCGTGTCGACGTCGTTTACCGGCGTCG
ATACCAGCTTCAAGGGTGTGTCGACTTCGTTCACGGGCGTAAGCACGAGCCTCACCGGTTCGAGCAACTC
GGTGACGGGCGTGTCGAACAGCATGACGGGCATCTCGTCATCATGGACCGACGTCAGCATGTCGACGACC
GGCCAATCCCAAAGCATCACGGGGGTATCGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGA
GCACGTCGGTGACGGGCACCTCGACGAGCATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAG
CATCACGGGCACGTCGATGTCGACGACGGGCAGCTCGACGAGCGTCACCGGCTCGAGCGTATCGACGACC
GGCAGCTCGGTGAGCACGACGGGCTCGAGCGTGTCGACAACGGGCAGCAGCGTGTCGACGACAGGTTTCA
GCTTCTCGTACACCGGCGTCAGTTATTCGGACACCGGTATTGACCTGAAGAAGGTCGGCATGCAAGTGAA
GAGCTGA