SecReT6
Protein ID: 403522037
SecReT6 ID696
T6SS typei3
Gene symbol-
Locus tagBPC006_II0752
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]750876..753164 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDK7PXZ6
KEGG IDbpq:BPC006_II0752
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-70, Aligned region: 23..327
Phage_base_V [PF04717], Evalue: 3.60E-22, Aligned region: 365..458
Protein Sequence: 762 a.a.     [Download]
>gi|403522037|ref|YP_006657606.1| Rhs element Vgr protein [Burkholderia pseudomallei BPC006]
MRLIELRSPLLDPDAVALSFVVHENLSQEPSYQLDLLSHDSNLDFDALLGSTLSADIDLGEGDIRTFNTH
VFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQDLSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYLPDGEESRAIQGREGV
QRLQRTRRIKSNNVALRDFDYHAPSKQLDSDAQVEQQSLGGIPLEYYDYAAGYRDPEQGERLARLRLEAI
QADAHALGGEANARALAVGRAFTLVGHPALSRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADDQ
PFRPLLVTKRPRVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVTQAWAGKGWGV
LAMPRVGQEVIVVYVDGDLDRPLATGIVYNGENPTPYDLPKDIRYTGLVTRSIKRAGGIPNASQLTFDDQ
HGAERVMIHAERDLQQTVERNSSTSIAQDLNLSVKGTSTSVVGISVSFTGISVSYTGLSVSFTGVSARFT
GVSTSFTGVSTSFTGVSTSFTGVDTSFTGVSTGFKGVDTSFTGVATSMVGVSTSITGSSNSVTGVSNSMT
GISSSWKDVSMSTTGQSESITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMSTT
GSSVSTTGSSMSATGSSVGTTGSSVSTTGSKMSVTGFSFSYTGASYEDVGVDLKKLGMQTKN
 
Nucleotide Sequence: 2289 bp     [Download]
>gi|403521294|ref|NC_018529.1|:750876-753164 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGCGTCTGATCGAACTGCGCAGTCCCCTGCTGGACCCGGACGCCGTCGCGCTGAGCTTCGTGGTGCACG
AGAACCTGTCGCAGGAGCCGTCGTATCAGCTCGATTTGCTGAGCCACGATTCGAATCTGGACTTCGACGC
GCTGCTCGGCTCGACGCTGTCGGCCGACATCGACCTGGGCGAAGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCTACGACACGGGGCAGATGAGCGGGCAATACACGTACACGCTGGAGCTGCGAAGCTGGT
TGTCGTTTCTCGCGGAGAACCGCAACAGCCGGATCTTCCAGGATTTGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAGCTCGAAGGCACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTTCAGGAAACGGATCTGAACTTCGTGAAGCGGCTGCTGGAGGACGAAGGGATCTACTTCT
GGGTGGAGCACGAGCCGGACCGTCATGTGGTGGTGATCTCGGACACGCAGCGGTTCGAGGATCTGCCGCT
GCCGAACGACACGCTGGAGTATTTGCCGGACGGCGAGGAGTCGCGCGCGATCCAGGGGCGCGAAGGGGTG
CAGCGGCTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTCGCGCTGCGGGATTTCGACTATCACGCGC
CGTCGAAGCAACTGGACAGCGACGCGCAGGTCGAGCAGCAGAGTCTCGGCGGCATTCCGCTCGAGTACTA
CGACTACGCGGCCGGCTACCGCGACCCCGAGCAGGGCGAGCGTCTCGCGCGGCTGCGGCTCGAAGCGATT
CAGGCTGATGCACACGCGCTCGGGGGCGAGGCGAACGCACGCGCGCTGGCGGTGGGTCGCGCGTTCACGC
TGGTCGGCCATCCGGCGCTGAGCCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCATCCA
GGACGGACCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTCGCCGACGATCAG
CCGTTTCGGCCGCTGCTCGTCACCAAGCGGCCGCGCGTGCCGGGCATCCAGAGCGCGACGGTGGTGGGCC
CGGAGATGTCGGAGGTGCATACCGACAAGCTCGGGCGGATTCGCGTGCACTTCCACTGGGACCGCTACAA
GACGACCGAGGCGGACGCGTCGTGCTGGATTCGCGTGACGCAGGCATGGGCGGGCAAGGGCTGGGGTGTG
CTCGCGATGCCGCGGGTCGGGCAGGAAGTCATCGTCGTGTATGTCGACGGCGATCTCGACCGGCCGCTCG
CGACGGGCATCGTCTACAACGGCGAAAACCCGACGCCTTATGACCTGCCGAAGGATATCCGCTACACGGG
CCTCGTCACACGCTCGATCAAGCGGGCGGGCGGCATTCCGAATGCGAGCCAACTGACGTTCGACGATCAG
CACGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACTTGCAGCAGACGGTCGAGCGCAACAGCTCGA
CGTCGATCGCGCAGGATTTGAACCTGTCGGTGAAGGGCACGTCGACGTCGGTCGTCGGCATCTCGGTCAG
CTTCACGGGCATCTCGGTGTCGTACACGGGGTTGTCGGTGAGCTTCACCGGCGTGTCGGCGAGGTTCACG
GGCGTGAGCACGTCGTTTACCGGCGTGAGCACGAGTTTCACCGGCGTGTCGACGTCGTTTACCGGCGTCG
ATACCAGCTTCACCGGCGTCTCGACCGGATTCAAGGGCGTCGACACGAGCTTCACCGGCGTCGCGACGTC
GATGGTGGGCGTGTCGACGAGCATCACGGGCTCCAGCAATTCCGTGACGGGCGTGTCGAACAGCATGACG
GGCATCTCGTCTTCCTGGAAGGACGTGAGCATGTCGACGACCGGCCAGTCCGAAAGCATCACGGGAGTAT
CGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGAGCACGTCGGTGACGGGCACCTCGACGAG
CATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAGCATCACGGGCACATCGATGTCGACGACG
GGCAGCTCGGTGAGCACGACGGGCTCGAGCATGTCGGCCACCGGCAGTTCGGTGGGCACGACGGGCTCGA
GCGTATCGACGACGGGAAGCAAGATGTCGGTCACCGGCTTCAGCTTCTCGTATACGGGAGCGAGCTACGA
GGATGTGGGCGTCGATCTGAAAAAGCTCGGGATGCAGACGAAGAACTGA