SecReT6
Protein ID: 403522042
SecReT6 ID696
T6SS typei3
Gene symbol-
Locus tagBPC006_II0757
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]757611..758204 [+]
Productlipoprotein
NoteTssJ
UniProt IDK7PXZ9
KEGG IDbpq:BPC006_II0757
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.20E-12, Aligned region: 19..154
Protein Sequence: 197 a.a.     [Download]
>gi|403522042|ref|YP_006657611.1| lipoprotein [Burkholderia pseudomallei BPC006]
MRHKMGPFKSIAAALALGVLAGCSAFSSSKPEEPRQLHVTLVGGARLNVAPTGEPRPVQTCVYVVTAADW
LPTQGGDDSSCASRGQDSTVVADSRHVIAPNQLLQFSLNLPRSGELWLVADADYARRPANYGPLRVRVEG
RGLIHMAVWLDRDGIYNALLPGPVPVGGAIAPAAVRPDEPPPERKTKTTYGTRRSRQ
 
Nucleotide Sequence: 594 bp     [Download]
>gi|403521294|ref|NC_018529.1|:757611-758204 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
GTGCGTCACAAGATGGGCCCCTTCAAATCGATCGCGGCGGCGCTCGCGCTCGGCGTGCTCGCCGGCTGCT
CGGCCTTCTCGTCGTCGAAGCCGGAAGAGCCGCGGCAGTTGCACGTGACGCTCGTCGGCGGCGCCCGGCT
GAACGTCGCGCCGACGGGCGAGCCGCGTCCGGTGCAGACGTGCGTGTATGTCGTGACCGCGGCCGACTGG
CTGCCGACGCAGGGCGGCGACGATTCGTCGTGCGCGTCGCGCGGGCAGGACAGCACGGTCGTCGCCGACT
CGCGGCACGTGATCGCGCCGAACCAGTTGCTGCAGTTCTCGCTGAACCTGCCGCGCTCGGGCGAGCTCTG
GCTCGTCGCCGACGCCGACTACGCGCGCCGGCCGGCGAACTACGGGCCGCTGCGCGTGCGCGTCGAGGGC
CGCGGCTTGATTCACATGGCTGTCTGGCTGGACCGCGACGGCATCTACAACGCGTTGTTGCCGGGGCCCG
TGCCCGTCGGCGGCGCGATCGCCCCGGCGGCGGTCCGCCCCGACGAGCCGCCGCCCGAGCGCAAGACGAA
AACCACCTATGGGACAAGGAGAAGCAGGCAATGA