SecReT6
Protein ID: 403522043
SecReT6 ID696
T6SS typei3
Gene symbol-
Locus tagBPC006_II0758
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]758243..759562 [+]
Producthypothetical protein
NoteTssK
UniProt IDK7QBA6
KEGG IDbpq:BPC006_II0758
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.20E-120, Aligned region: 7..434
Protein Sequence: 439 a.a.     [Download]
>gi|403522043|ref|YP_006657612.1| hypothetical protein BPC006_II0758 [Burkholderia pseudomallei BPC006]
MLIETQHFQQLERHLAHQASLRLGQTSNHGWGFTLLDLDQDGLGLGRLGLRHARGVFQDGTAFSLPSDDP
LPPPLETELAQAGDIACLALQAARTGGPEMAFGDVELASRYRAVSTEVPDLAVGLDAPGTPRRLTIETGQ
LVTRLCWKSQLRSDEVALPIARVAGRNASRTVSLDPRFIPPLLDTRAHLVLRSLIDELQSTLRVRLASTS
AQRVLSTGGGVADLIELLLRQAIAEYRMRLANLDAFDPLPPAMLYHELVGLLGRLSVLPGVDEELADREL
GYDHDDLQTSFEPLAMMLRQALARVIETPVLPLRFEDRGDQVHICIVDKQWNLKKLIFAFSAAMPAEKLR
QLLPQQTKLGAVEQIQKLVDLQLPGARLNALPNPPRQIPYYAQSTYFEVESTDPFWKQTLAGSAMALRIV
GDFPDLRFEAWGLRDGKVA
 
Nucleotide Sequence: 1320 bp     [Download]
>gi|403521294|ref|NC_018529.1|:758243-759562 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGCTGATCGAGACGCAGCACTTCCAGCAGCTCGAGCGGCATCTCGCGCATCAGGCCTCGCTGCGGCTCG
GTCAGACGTCGAATCACGGCTGGGGCTTCACGCTGCTCGATCTCGACCAGGACGGCCTGGGGCTCGGCCG
GCTCGGGCTGCGCCACGCGCGCGGCGTGTTCCAGGACGGCACCGCGTTCTCGCTGCCGTCGGACGATCCG
CTGCCGCCGCCGCTGGAAACCGAGCTCGCGCAGGCGGGCGACATCGCGTGCCTCGCGCTGCAGGCCGCGC
GCACGGGCGGCCCGGAGATGGCGTTCGGCGACGTCGAGCTGGCGTCGCGCTATCGCGCGGTGTCGACCGA
GGTGCCGGATCTCGCGGTCGGGCTCGACGCGCCCGGCACGCCGCGGCGCCTGACGATCGAGACGGGCCAG
CTCGTCACGCGCCTGTGCTGGAAGTCGCAGCTGCGCTCGGACGAGGTCGCGCTGCCGATCGCGCGCGTGG
CGGGGCGCAACGCGAGCCGCACGGTGTCGCTGGATCCGCGCTTCATTCCGCCGCTGCTCGACACGCGCGC
GCACCTGGTGCTGCGCTCGCTGATCGACGAGCTGCAGAGCACGCTGCGCGTGCGGCTCGCGAGCACGTCC
GCGCAGCGCGTGCTGTCGACGGGCGGGGGCGTGGCCGATCTGATCGAGCTGCTGCTGCGCCAGGCGATCG
CCGAGTACCGGATGCGCTTGGCGAACCTCGACGCGTTCGATCCGCTGCCGCCGGCGATGCTGTATCACGA
GCTGGTCGGCCTGCTCGGGCGGCTGAGCGTGCTGCCGGGCGTCGACGAGGAGCTGGCCGACCGCGAGCTC
GGCTACGACCACGACGATCTGCAGACGAGCTTCGAGCCGCTCGCGATGATGCTGCGCCAGGCGCTCGCGC
GCGTGATCGAGACGCCGGTGTTGCCGCTGCGCTTCGAGGATCGCGGCGATCAGGTGCACATCTGCATCGT
CGACAAGCAGTGGAACCTGAAGAAACTGATTTTTGCGTTTTCGGCCGCGATGCCGGCGGAGAAGCTGCGG
CAACTGTTGCCGCAGCAGACGAAGCTGGGCGCCGTCGAGCAGATCCAGAAGCTCGTGGACCTGCAACTGC
CGGGCGCGCGGCTGAACGCGCTGCCCAATCCCCCGCGCCAGATTCCCTACTACGCCCAAAGCACGTACTT
CGAAGTGGAATCGACCGATCCGTTCTGGAAGCAGACCCTCGCCGGCTCGGCGATGGCGCTGCGCATCGTC
GGCGATTTCCCCGATCTTCGCTTCGAAGCCTGGGGGCTGAGAGACGGCAAGGTGGCGTGA