SecReT6
Protein ID: 403522044
SecReT6 ID696
T6SS typei3
Gene symbol-
Locus tagBPC006_II0759
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]759588..761303 [+]
Producthypothetical protein
NoteTssL
UniProt IDK7PYZ1
KEGG IDbpq:BPC006_II0759
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-43, Aligned region: 141..336
OmpA [PF00691], Evalue: 5.10E-10, Aligned region: 395..502
Protein Sequence: 571 a.a.     [Download]
>gi|403522044|ref|YP_006657613.1| hypothetical protein BPC006_II0759 [Burkholderia pseudomallei BPC006]
MSLLRNLSSTLRRVSMASNMLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPS
FAPPAADAFPQADGAPRNPAVLQFPVPGGAPAPADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSH
ALPAVLQLQRHLAAGPLNQAAIRTQLGLEVRLYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHA
QVVYDGERSLLVEFHDDAWGGEDAFADLSRWMKTEPPPIPLLSFYELILSLGWQGRYRVLDRGDVLLQDL
RSQLHALIWHHVPPEPLGTELVAPAKRRRSWWTAGRAAAVALGVLVLAYGAISFWLDSQGRPIRNALAAW
MPPTRTINIAETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIERLGLAFAPW
PGDLEVIGHTDSRPIRTSEFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPID
TAKTAAAYERNRRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYATSTTMP
ATRPTTEGRQP
 
Nucleotide Sequence: 1716 bp     [Download]
>gi|403521294|ref|NC_018529.1|:759588-761303 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGAGCCTGCTACGAAACCTCTCCTCCACGCTGCGCCGCGTATCGATGGCATCCAACATGCTCGATCGCG
CGGCGGCGAATCCGGATCTCGTGACGCGCGTGCCGACGCTGTCGTCGCTGTCGAGCGCGGCGATGACGAG
CTCCGCCGTATCGACCACCGGCACGACGAACACGGTGGCGTCGGGCGGCGCGGCCGCGGGCGCGCCGAGC
TTCGCGCCGCCGGCCGCCGACGCGTTTCCCCAAGCCGACGGCGCGCCCCGCAACCCCGCGGTGCTGCAAT
TCCCGGTGCCGGGCGGCGCGCCCGCGCCCGCCGACGCGCGGGTGGCCGCGCCCGTCGTCTACAGCGCGCA
GGGCGAGCAGGCCGCGATCATGAAAGCAGGCCTGCAGCAGGCGAGCTGGAACAACCCGTTCGTGTCGCAC
GCGCTGCCCGCGGTGCTGCAACTGCAGCGCCACCTCGCGGCCGGCCCGCTCAATCAGGCCGCGATCCGCA
CGCAGCTCGGCCTCGAGGTGCGGCTCTACCGCGAGCGGCTCGCCGCCTCCGGCTGCGAATGGGAGCAGAT
CCGCGACGCGTCGTACCTGCTCTGCACGTATCTCGACGAAACCGTCAACGACGCGGCGCGCGAGCACGCG
CAAGTCGTCTACGACGGCGAGCGCAGCCTGCTCGTCGAATTCCACGACGACGCGTGGGGCGGCGAGGACG
CGTTCGCCGACCTGTCGCGCTGGATGAAGACCGAGCCGCCGCCGATTCCGCTTCTGTCGTTCTACGAACT
GATCCTGTCGCTCGGCTGGCAGGGCCGCTACCGCGTGCTCGACCGCGGCGACGTGCTGCTGCAGGATCTG
CGCTCGCAACTGCACGCGCTGATCTGGCATCACGTGCCGCCCGAGCCGCTCGGCACCGAGCTCGTCGCGC
CCGCGAAGCGGCGCCGCTCGTGGTGGACGGCCGGGCGCGCGGCGGCCGTCGCGCTCGGCGTGCTGGTGCT
CGCGTACGGCGCGATCAGCTTCTGGCTCGATTCGCAGGGCCGCCCGATCCGCAACGCGCTCGCCGCGTGG
ATGCCGCCCACGCGCACGATCAACATCGCCGAGACGCTGCCGCCGCCGCTGCCGCAGATTCTCACCGAAG
GGTGGCTCACCGCGTACAAGCATCCGCAAGGATGGCTGCTCGTGTTCAAGAGCGACGGCGCGTTCGACGT
CGGCAAGGCGAACGTGCGGGCGGACTTCATGCACAACATCGAGCGGCTCGGCCTCGCGTTCGCGCCGTGG
CCGGGCGACCTCGAGGTGATCGGCCACACCGATTCGCGGCCGATCCGCACGAGCGAGTTCCCGGACAACC
AGGCGCTGTCCGAAGCGCGGGCGCGCAACGTCGCCGACGAACTGCGCAAGACCGCGCTGCCGGGCGGCGC
GCGCGCGCCGGAGAACGCGGTGCAGCGCAACATCGAGTACTCGGGGCGCGGCGACGCGCAGCCGATCGAC
ACCGCGAAGACGGCCGCCGCGTACGAGCGCAACCGCCGCGTCGACGTGCTGTGGAAGGTGATTCCCGACG
GCGCGCAGCAATCGGGCCGCAGCCTGAACCTGCAGCAGCCGGAGAAGCCCGGGCAGGTGCCGATGCGTCC
GGCGATGCCGGAGGGCGTGGAGATCGCGCCTGACGGGCAACTGCCGTATGCGACGTCAACCACGATGCCA
GCAACGCGACCGACCACGGAGGGCCGTCAGCCATGA