SecReT6
Protein ID: 403523289
SecReT6 ID697
T6SS typei1
Gene symbol-
Locus tagBPC006_II2009
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2047738..2049237 [+]
Producthypothetical protein
NoteTssC
UniProt IDK7Q1P8
KEGG IDbpq:BPC006_II2009
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-187, Aligned region: 72..497
Protein Sequence: 499 a.a.     [Download]
>gi|403523289|ref|YP_006658858.1| hypothetical protein BPC006_II2009 [Burkholderia pseudomallei BPC006]
MEGEHLQSPKHDDAPDATPPESPASLLDELIEAARVKRDEDAYPITRHGIQAFVAHLAKPKRPIETVSQA
TIDDMIAEIDRKLCRQIDAILHDPAFQQLESTWRSLKFLVDRTDFRENVKVQILDVGKTALFDDFEDSPD
ITKSGLYQKVYTAEYGQFGGQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFIAAAGPAFFGIDSF
GKLPNVKDLASLFEGPQYAKWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYEERVDGGDAHFL
WGNAAFAFATRLTASFADYRWCANVIGPKGGGTVTDLPLYAYESMGEIQNKIPTDVLISERREFELAEQG
FIALTMRKNSDNAAFFSANSTQKPKFFGISKEGKEAELNYRLSTQLPYIFVVNRLAHYIKVIQRENIGSW
KERGDLEQELNQWIRQYVVDMDNPSQSVRSRRPLRQAQIVVSDVEGEPGWYRVDMKVRPHFKYMGAFFTL
SLVGKLEKR
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|403521294|ref|NC_018529.1|:2047738-2049237 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGGAAGGCGAACACCTGCAATCCCCGAAGCACGACGACGCGCCGGACGCGACGCCGCCCGAGTCCCCCG
CCTCGCTGCTCGACGAGCTGATCGAGGCCGCGCGCGTGAAGCGCGACGAAGACGCATACCCGATCACGCG
CCACGGCATCCAGGCGTTCGTCGCGCATCTGGCGAAGCCCAAGCGCCCGATCGAGACCGTGAGCCAGGCG
ACGATCGACGACATGATCGCCGAGATCGACCGCAAGCTGTGCCGGCAGATCGACGCGATCCTCCATGACC
CGGCATTCCAGCAACTCGAATCGACGTGGCGCTCGCTGAAGTTTCTCGTCGATCGAACGGATTTCCGCGA
GAACGTGAAGGTTCAGATTCTCGACGTCGGCAAAACGGCGCTGTTCGACGACTTCGAGGATTCGCCCGAC
ATCACGAAATCCGGGCTGTACCAGAAGGTCTATACGGCCGAGTACGGCCAATTCGGCGGCCAGCCGATCG
GCGCGATCGTCGCGAACTACACGTTCGGGCCCGGCGCGCAGGACGTCAAGCTGCTGCAGTACGTCGCGAG
CACGTCGGCGATGGCGCATACGCCGTTCATCGCGGCGGCGGGCCCCGCGTTCTTCGGCATCGATTCGTTC
GGCAAGCTGCCGAACGTAAAGGATCTCGCCTCGCTGTTCGAGGGGCCGCAATACGCGAAATGGAATGCGT
TTCGCGAAAGCGAGGACGCGCGCTACGTCGGCCTCACGCTGCCGCGCTTCTTGCTGCGGCTGCCTTACGG
CGCGAACACGACGCCCGTCAAGCGCTTCAACTACGAGGAGCGCGTCGACGGCGGCGACGCGCATTTTCTG
TGGGGCAACGCGGCGTTCGCGTTCGCGACGCGCCTCACCGCGAGCTTCGCCGACTATCGCTGGTGCGCGA
ACGTGATCGGGCCGAAAGGCGGCGGAACGGTGACCGATCTGCCGCTCTACGCGTACGAATCGATGGGCGA
GATCCAGAACAAGATCCCGACCGACGTGCTGATTTCCGAGCGCCGCGAGTTCGAGCTCGCCGAACAGGGC
TTCATCGCGCTGACGATGCGCAAGAACAGCGACAACGCCGCCTTTTTCTCCGCGAACTCCACGCAGAAGC
CGAAGTTCTTCGGCATCAGCAAGGAAGGCAAGGAGGCCGAGCTCAACTATCGGCTCAGCACGCAACTGCC
GTACATCTTCGTCGTCAACCGGCTCGCCCATTACATCAAGGTGATCCAGCGGGAAAACATCGGCTCGTGG
AAGGAGCGCGGCGATCTCGAGCAGGAGCTCAACCAGTGGATCCGCCAGTACGTCGTCGACATGGACAACC
CGTCGCAGAGCGTGCGCAGCCGCCGCCCGCTGCGGCAGGCGCAGATCGTCGTGTCGGACGTCGAGGGCGA
ACCCGGCTGGTATCGCGTGGACATGAAGGTGCGGCCGCACTTCAAGTACATGGGCGCGTTCTTCACGCTG
TCGCTCGTCGGCAAGCTCGAAAAGCGCTAG