SecReT6
Protein ID: 403523291
SecReT6 ID697
T6SS typei1
Gene symbol-
Locus tagBPC006_II2011
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2049959..2050420 [+]
Producthypothetical protein
NoteTssE
UniProt IDK7Q8S6
KEGG IDbpq:BPC006_II2011
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.70E-19, Aligned region: 39..130
Protein Sequence: 153 a.a.     [Download]
>gi|403523291|ref|YP_006658860.1| hypothetical protein BPC006_II2011 [Burkholderia pseudomallei BPC006]
MADRESSRAGEPRTRERRLLERIANREAGGEHDRPPPADVLAHSIIDHLRRILNTRQGHVPIDPAFGVPD
FTNLAGGFAQGSAREIEAQIERVITCYEPRLKAPRVSLAERGPDAATLRFSLDARLVIDAHDVPARFLTT
VTGNGKIDIRTIS
 
Nucleotide Sequence: 462 bp     [Download]
>gi|403521294|ref|NC_018529.1|:2049959-2050420 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGGCTGATCGCGAATCGTCGCGGGCCGGCGAGCCGCGCACGCGCGAGCGCCGGCTGCTCGAGCGGATCG
CGAACCGGGAAGCGGGCGGCGAGCACGATCGCCCGCCGCCCGCCGACGTGCTCGCGCACTCGATCATCGA
CCACCTGCGCCGCATCCTGAACACGCGGCAGGGCCACGTGCCGATCGATCCCGCCTTCGGCGTGCCGGAT
TTCACGAATCTCGCGGGCGGCTTCGCGCAAGGCTCCGCCCGCGAAATCGAAGCGCAGATCGAGCGCGTGA
TCACCTGCTACGAGCCGCGGCTGAAAGCGCCGCGCGTCTCGCTCGCCGAGCGCGGGCCCGATGCGGCGAC
GCTGCGCTTCAGCCTCGATGCGCGGCTCGTGATCGACGCGCACGACGTGCCGGCGCGCTTTCTGACGACC
GTCACCGGCAACGGAAAGATCGATATCCGAACGATTTCCTGA