SecReT6
Protein ID: 403523292
SecReT6 ID697
T6SS typei1
Gene symbol-
Locus tagBPC006_II2012
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2050457..2052199 [+]
Producthypothetical protein
NoteTssF
UniProt IDK7Q0V5
KEGG IDbpq:BPC006_II2012
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.30E-161, Aligned region: 7..580
Protein Sequence: 580 a.a.     [Download]
>gi|403523292|ref|YP_006658861.1| hypothetical protein BPC006_II2012 [Burkholderia pseudomallei BPC006]
MATTTPNRYYEDELVRLRELAAEFARAHPLLAPMLGAPSGDPDVERLLEGVAFLTGLARQKLDEGLPELV
QALANLLFPHSLRPVPAATLIAFEPRGALRERAVIAAGTEIESVPVDGTACRFRTCGELDIEPIALAGCR
FVPPAHGGPALRLDFEMLGLDASEWDATRIRLFIGGERLHASRLFALLMQHVVAVEIAGGPPELPGPRCA
LGARALRPAGFDDALLPCPERAFPGFRLLHEYFAFAEKFLFVELGGLERWRAARAGAQFSVWLALDSAPD
WLPGIDRDSFRLNVAAALNLFAHEAVPIQHEHRATDYRLQPEGDTSGHYRIYSVDRVIGYRPGHAVDRHY
VPFGVAGDDANAASYRLIRRAALDGHGQDLHLALAYPPGEALATETLSIGLSCTNGALPARLKIGDVCRA
TDSSPERFTFANIAPVSPPLDPPLGEPLLWRTISHLALNFLSLGDADHLKRMLALHAFGERGDDARAQAD
RRRIDGIESVDVRAETRIIGERMLSGQRVALRCSAHAFGGAGELYLFGCVLERFLAEYAAINTYTRVEID
ASPDGVRFAWPPRMGAQCLL
 
Nucleotide Sequence: 1743 bp     [Download]
>gi|403521294|ref|NC_018529.1|:2050457-2052199 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGGCCACCACCACGCCCAATCGCTATTACGAGGACGAGCTCGTTCGCCTGCGCGAGCTCGCCGCCGAGT
TCGCCCGCGCGCACCCGCTGCTCGCGCCGATGCTCGGCGCGCCGTCGGGCGACCCGGACGTCGAGCGGCT
GCTCGAAGGCGTCGCGTTCCTGACGGGGCTCGCGCGGCAAAAGCTCGACGAAGGCCTGCCGGAGCTCGTG
CAGGCGCTCGCGAACCTGCTGTTTCCGCACTCGCTGCGCCCGGTGCCGGCGGCCACGCTGATCGCGTTCG
AGCCGCGCGGCGCGCTGCGCGAGCGCGCGGTGATCGCGGCCGGCACCGAGATCGAATCGGTGCCCGTCGA
CGGCACCGCCTGCCGGTTTCGCACGTGCGGCGAGCTCGACATCGAGCCGATCGCGCTCGCCGGCTGCCGG
TTCGTGCCGCCCGCGCACGGCGGGCCCGCGCTGCGGCTCGACTTCGAGATGCTCGGCCTCGACGCGAGCG
AATGGGACGCGACGCGCATTCGGCTGTTCATCGGCGGCGAGCGGCTGCACGCAAGCCGCCTGTTCGCGCT
GCTGATGCAGCACGTCGTAGCGGTCGAGATCGCAGGCGGCCCGCCCGAGCTGCCCGGCCCGCGCTGCGCG
CTCGGCGCCCGCGCGCTGCGCCCGGCGGGCTTCGACGACGCGCTGCTGCCCTGCCCCGAGCGGGCGTTCC
CCGGCTTCCGGCTGCTGCACGAATATTTCGCGTTCGCCGAGAAATTCCTGTTCGTCGAGCTGGGCGGCCT
CGAGCGCTGGCGCGCGGCGCGCGCGGGCGCGCAGTTCAGCGTATGGCTCGCGCTCGACAGCGCGCCCGAC
TGGCTGCCCGGCATCGATCGCGACAGCTTCCGGCTGAACGTCGCCGCCGCGCTGAACCTGTTCGCGCACG
AAGCGGTGCCGATCCAGCACGAGCATCGCGCGACCGATTACCGGCTGCAGCCCGAAGGCGACACGTCGGG
CCACTACCGGATCTACTCGGTCGACCGCGTGATCGGCTACCGCCCCGGCCACGCGGTCGACCGCCATTAC
GTGCCGTTCGGCGTCGCGGGCGACGACGCGAACGCCGCGAGCTACCGGCTGATTCGCCGCGCCGCGCTCG
ACGGCCACGGGCAGGATCTCCATCTGGCGCTCGCCTACCCGCCCGGCGAGGCGCTCGCCACGGAAACGCT
GTCGATCGGCCTGTCGTGCACGAACGGCGCGTTGCCCGCGCGCCTGAAGATCGGCGACGTGTGCCGCGCG
ACCGACAGCTCGCCCGAGCGCTTCACGTTCGCCAACATCGCGCCCGTGAGCCCGCCGCTCGATCCGCCGC
TCGGCGAACCGCTGCTGTGGCGCACCATCAGCCATCTCGCGCTGAACTTCCTGTCGCTCGGCGACGCCGA
TCATCTGAAGCGCATGCTCGCGCTCCACGCGTTCGGCGAACGCGGCGACGACGCGCGCGCGCAAGCCGAC
CGCCGCCGCATCGACGGCATCGAATCGGTCGACGTGCGGGCCGAGACGCGGATCATCGGCGAGCGGATGC
TGAGCGGCCAGCGCGTGGCGCTGCGCTGCAGCGCCCATGCGTTCGGCGGCGCGGGCGAGCTGTATCTGTT
CGGCTGCGTGCTCGAGCGCTTTCTGGCCGAATACGCGGCGATCAACACCTACACGCGCGTCGAGATCGAC
GCGTCGCCCGACGGCGTGCGCTTCGCGTGGCCGCCGCGAATGGGGGCGCAATGCCTGCTCTAG