SecReT6
Protein ID: 403523293
SecReT6 ID697
T6SS typei1
Gene symbol-
Locus tagBPC006_II2013
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2052163..2053209 [+]
Producthypothetical protein
NoteTssG
UniProt IDK7QC06
KEGG IDbpq:BPC006_II2013
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.80E-81, Aligned region: 19..319
Protein Sequence: 348 a.a.     [Download]
>gi|403523293|ref|YP_006658862.1| hypothetical protein BPC006_II2013 [Burkholderia pseudomallei BPC006]
MAAANGGAMPALEPVLLGEAKHFAYFQAIRLLRRIARERRGDAAGRPDAPLPIHTRPNLSLSFPDTDVER
IDKADDGGYRVVANFFGLYGVSSPLPTFYTEDLIDEAFRGRHAARGFLDVLHRALYPLLFDAWLKHRLAL
RIVEERDEHALRPLYALAGVDARIARDAGLHEHALLRYVGLLSQRPRSAAGLRALLADAFAPATVDIEPC
VPQWLPIPDDQRTRVGTRARRLGADARVGARMRDDGARLRIVLGDVPGPLFRALMPGGDAFARLRLLVRL
YLTQPFAVDVVVRVRARDAAPARCGRRAWSRVGLDAWLGGPSAERAASPEFRLPTSLFDQARPHHAAG
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|403521294|ref|NC_018529.1|:2052163-2053209 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
GTGGCCGCCGCGAATGGGGGCGCAATGCCTGCTCTAGAACCCGTTCTGCTCGGCGAGGCGAAGCACTTCG
CGTATTTCCAGGCGATCCGGCTGCTGCGGCGCATCGCGCGCGAACGGCGCGGCGACGCCGCGGGGCGGCC
CGACGCGCCGCTGCCGATCCACACGCGGCCGAATCTCTCGCTGTCGTTTCCGGACACCGACGTCGAGCGC
ATCGACAAGGCCGACGACGGCGGCTACCGGGTCGTCGCGAACTTCTTCGGTCTGTACGGCGTGTCCTCGC
CGCTGCCGACGTTCTACACCGAGGACCTGATCGACGAAGCGTTCAGGGGCCGCCACGCGGCGCGCGGCTT
TCTCGACGTGCTGCATCGCGCGCTCTATCCGCTGCTGTTCGACGCGTGGCTCAAGCATCGGCTGGCGCTG
CGGATCGTCGAGGAACGCGACGAGCACGCGCTGCGCCCGCTCTACGCACTCGCGGGCGTCGACGCGCGCA
TCGCGCGCGACGCGGGCCTGCACGAGCACGCGCTGCTGCGCTACGTCGGGCTGCTCAGCCAGCGGCCGCG
CTCCGCGGCCGGTCTGCGCGCGCTGCTCGCCGACGCGTTCGCGCCCGCGACGGTCGACATCGAGCCGTGC
GTGCCGCAATGGCTGCCGATTCCGGACGACCAGCGCACCCGCGTCGGCACGCGCGCGCGCCGGCTCGGCG
CCGACGCGCGGGTCGGCGCGCGCATGCGCGACGACGGCGCCCGGCTGCGGATCGTGCTCGGCGACGTGCC
CGGCCCGCTGTTCCGCGCGCTGATGCCGGGCGGCGATGCGTTTGCCCGGCTGCGCTTGCTCGTACGCCTG
TATCTGACCCAACCGTTCGCCGTGGACGTCGTGGTGCGCGTGCGCGCGCGCGACGCGGCCCCCGCGCGCT
GCGGCCGCCGCGCGTGGTCGCGCGTCGGGCTCGACGCGTGGCTGGGCGGCCCGAGCGCGGAACGCGCGGC
GTCGCCCGAATTCCGTCTTCCGACTTCCCTCTTTGATCAAGCGAGACCCCATCATGCTGCTGGTTGA