SecReT6
Protein ID: 403523301
SecReT6 ID697
T6SS typei1
Gene symbol-
Locus tagBPC006_II2021
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2065020..2066453 [+]
Producthypothetical protein
NoteTssK
UniProt IDK7Q8T6
KEGG IDbpq:BPC006_II2021
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.00E-98, Aligned region: 28..474
Protein Sequence: 477 a.a.     [Download]
>gi|403523301|ref|YP_006658870.1| hypothetical protein BPC006_II2021 [Burkholderia pseudomallei BPC006]
MTHDASRTGTNDMDNVYWHQGMLLQPQHFQLAELHQQFRFEPWLACGPPHFWGVGALSLAQAAIDRRVVE
IRSTRLLFADRSYVEYPGNAVVAARAFDPAWLDEGRALVAHVALRRLARGANNVTVAAAPDALPDAPTRY
ATLPSAEEVADLHSDHPGAPVRTLKHVLKIVFEHELDALAAHETIPIARIVRDGERLRLDDDFAPPCYAL
SGSRTLLERVRCIRDELAGRARQLQQYKNPREMQRAEFDASYAAFLLALRSLNRFGPLLFHLAECDGQHP
WTVYGVLRQLVGELSVFSERFDMLGETPDARGGLPPYDHRDLGGCFSRAHALIGHLLDEIAVGPDCVATF
EPDGPQQPAQRSAQLPPDVFADRHQIYLAIRSAHDPDTLAQRFALGGRIAATDEMPQLTALALPGVELTR
LPGPPPRLPRRGDARYFRIEQAGRPWDAIRRDGRVSLRWADAPDDLHAELVAVRHTQ
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|403521294|ref|NC_018529.1|:2065020-2066453 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGACGCACGACGCATCACGAACCGGAACGAACGACATGGACAACGTCTATTGGCATCAGGGGATGCTGC
TGCAACCGCAACATTTTCAGTTGGCCGAACTGCACCAGCAGTTCCGCTTCGAGCCGTGGCTCGCGTGCGG
CCCACCGCATTTCTGGGGCGTCGGCGCGCTGTCGCTCGCGCAGGCCGCGATCGATCGCCGCGTGGTCGAG
ATCCGCTCGACGCGCCTGCTGTTCGCCGACCGCAGCTACGTCGAATATCCGGGCAACGCGGTCGTCGCCG
CGCGCGCGTTCGATCCCGCGTGGCTCGACGAAGGCCGCGCGCTCGTCGCGCACGTCGCGCTCAGGCGGCT
CGCGCGCGGCGCGAACAACGTGACGGTCGCGGCCGCGCCCGACGCGCTGCCCGACGCCCCGACGCGCTAC
GCGACGCTGCCGTCCGCCGAGGAGGTCGCCGATCTGCATTCGGACCATCCGGGCGCGCCGGTGCGCACGC
TCAAGCACGTGCTGAAGATCGTGTTCGAGCACGAGCTCGACGCGCTCGCCGCGCACGAAACGATCCCGAT
CGCGCGGATCGTGCGCGACGGCGAGCGCCTGCGGCTCGACGACGATTTCGCGCCGCCCTGCTACGCGCTG
TCGGGCTCGCGCACGCTGCTCGAGCGCGTGCGCTGCATTCGCGACGAGCTCGCGGGCCGCGCGCGGCAGT
TGCAGCAGTACAAGAATCCGCGCGAGATGCAACGCGCCGAATTCGACGCGAGCTATGCGGCGTTCCTGCT
CGCGCTGCGTTCGCTGAACCGCTTCGGCCCGCTGCTGTTCCATCTCGCCGAATGCGACGGGCAGCATCCA
TGGACGGTCTACGGCGTGCTGCGCCAACTCGTCGGCGAGCTGAGCGTGTTCTCCGAGCGCTTCGACATGC
TCGGCGAGACGCCCGATGCGCGCGGCGGCCTGCCGCCGTACGACCACCGCGATCTGGGCGGCTGCTTCTC
GCGCGCGCACGCGCTGATCGGCCACCTGCTCGACGAAATCGCGGTGGGCCCGGACTGCGTCGCGACGTTC
GAGCCCGACGGCCCGCAGCAGCCCGCGCAACGCTCGGCGCAACTGCCGCCCGACGTGTTCGCGGATCGCC
ACCAGATCTATCTCGCGATCCGCAGCGCGCACGATCCGGACACGCTCGCGCAACGCTTCGCGCTCGGCGG
CCGGATCGCGGCGACCGACGAAATGCCGCAGCTCACCGCGCTCGCGCTGCCGGGCGTCGAACTCACCCGC
CTGCCCGGCCCGCCGCCGCGGCTGCCGCGCCGCGGCGACGCGCGCTACTTCCGGATCGAGCAGGCCGGCC
GCCCGTGGGACGCGATCCGGCGTGACGGCCGCGTGTCGCTGCGCTGGGCCGACGCGCCGGACGACCTGCA
CGCGGAACTCGTCGCGGTGAGGCACACGCAATGA