SecReT6
Protein ID: 403523302
SecReT6 ID697
T6SS typei1
Gene symbol-
Locus tagBPC006_II2022
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2066450..2067115 [+]
Producthypothetical protein
NoteTssL
UniProt IDK7Q0W7
KEGG IDbpq:BPC006_II2022
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.10E-44, Aligned region: 1..208
Protein Sequence: 221 a.a.     [Download]
>gi|403523302|ref|YP_006658871.1| hypothetical protein BPC006_II2022 [Burkholderia pseudomallei BPC006]
MKLTDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDHAACAGAPAADVDDALFAVCAWIDEALLN
SGWDDADRWTLRLLQKRYFDTSHAGVVFFERLGTLDGARASVLEVYLLCLRLGFRGRYGYDGGDGPLDAI
RQRALDALSAHAPPCAAGEPPFPAAYAHAGPHAAAAKARTRRRIARAGLSVGLPLAILLSLYLIYHVVIV
RMVDAVYPRLQ
 
Nucleotide Sequence: 666 bp     [Download]
>gi|403521294|ref|NC_018529.1|:2066450-2067115 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGAAGCTGACCGATTCGATGATGCCGCTCGTCGCGTATGCGCGGCAGCTCGCGCAATCGCCGCGCGGCG
ACGCCGCCGAAGTCGCGCTGCGGCTCGACATCCTGATCGAGCGCGCGCGCGACCACGCGGCGTGCGCGGG
CGCACCCGCGGCCGACGTCGACGACGCGCTGTTCGCGGTGTGCGCGTGGATCGACGAGGCGCTGCTGAAC
AGCGGCTGGGACGATGCCGATCGCTGGACGCTGCGGCTGCTGCAAAAGCGCTACTTCGATACGTCGCACG
CGGGCGTCGTGTTCTTCGAACGCCTCGGCACGCTCGACGGCGCGCGCGCGAGCGTGCTCGAGGTCTACCT
GCTGTGCCTGCGGCTCGGCTTTCGCGGCCGCTACGGCTACGACGGCGGCGACGGCCCGCTCGACGCGATC
CGCCAGCGCGCGCTCGATGCACTGTCGGCGCACGCGCCGCCGTGCGCCGCGGGCGAGCCGCCGTTTCCCG
CCGCCTATGCGCACGCCGGCCCGCACGCCGCCGCCGCGAAAGCGCGCACGCGCCGCCGGATCGCGCGCGC
GGGGCTGAGCGTCGGGCTGCCGCTCGCCATCCTGCTGTCGCTCTATCTGATCTATCACGTCGTCATCGTG
CGGATGGTCGACGCGGTGTACCCCAGGCTGCAATGA