SecReT6
Protein ID: 403524051
SecReT6 ID698
T6SS typei3
Gene symbol-
Locus tagBPC006_II2773
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2799866..2802070 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDK7QA98
KEGG IDbpq:BPC006_II2773
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.30E-84, Aligned region: 25..325
Phage_GPD [PF05954], Evalue: 2.30E-84, Aligned region: 570..667
Phage_base_V [PF04717], Evalue: 4.30E-24, Aligned region: 53..75
Phage_base_V [PF04717], Evalue: 4.30E-24, Aligned region: 364..456
Phage_base_V [PF04717], Evalue: 4.30E-24, Aligned region: 655..671
Gp5_C [PF06715], Evalue: 4.60E-06, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 4.60E-06, Aligned region: 530..547
Gp5_C [PF06715], Evalue: 4.60E-06, Aligned region: 556..571
Gp5_C [PF06715], Evalue: 4.60E-06, Aligned region: 585..603
Gp5_C [PF06715], Evalue: 4.60E-06, Aligned region: 644..664
Gp5_C [PF06715], Evalue: 4.60E-06, Aligned region: 722..728
Protein Sequence: 734 a.a.     [Download]
>gi|403524051|ref|YP_006659620.1| Rhs element Vgr protein [Burkholderia pseudomallei BPC006]
MSRVFTLDSPHGDGLKFHTLDGSDELGRLFEFRIEALADSHSLSLKDLLGKPVTVRIEQQGQSTRYLNGI
VARASLAGRRAERYYGYELLVRPWLWLATRRSDCRIFQNKTVPEIVQEVLSTYGFPIENHLAESYVPREY
CVQYNGTDAAFVSRLMEFEGIYYWFRHAEDTHTLMLSDAMSSHTALPGYETIPYIARDRTVIADVEHIDG
WLPARQVSVGKHQTTDYDYTKPRADLSSQKVDPRGHDHDSFASFEWPGGYRDDAPGAHYSRVRLEEQQAE
HERASADTDVRGAAPGYLFTLAHCPRADRNREYLIVRCQYRFQENAYASDQGTEAVVHQTMMLVRPSSLP
YRSPRETPRPRTNGPQTATVVGPPGEEIWTDQYGRVKLQFRWDRYGQSNQDSSCWVRVSSPWAGGGFGGV
QIPRVGDEVVVDFLNGDPDEPIVTGRVYNGERMPPWGLPGSATQSGLLSRSSPGGTTEHANAFRFEDKKG
AEQLWMHAERNFDAETEADHSLSIEHDHTHTVGNDETMQVRNNRQRSVGQDETVNIGRHRVAQIKGNETQ
GVVGDRTRTVGKKETVTIVSDREATIGGNHMETVVKDKTESIGEGKTLNVVKHYQTNSKSMKTTVAEHHV
EEIGERTSTIAHAHTLTVRGEHAVSVGANHTTNVQHQVLVNAGDQRALVCGKSSVLMKSDGTILIQGVNV
ESSGSDSHSVRGKKVTSSASVEHTVEGTVLKLNP
 
Nucleotide Sequence: 2205 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c2802070-2799866 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
GTGAGTCGCGTATTCACACTCGACAGCCCGCACGGCGACGGCCTGAAATTCCACACGCTCGACGGCAGCG
ACGAACTCGGCCGGCTGTTCGAATTCCGGATCGAGGCGCTCGCCGACAGTCACAGCCTGTCGCTGAAGGA
CCTGCTCGGCAAGCCCGTCACCGTCCGGATCGAACAGCAGGGCCAGTCGACGCGCTACCTGAACGGCATC
GTTGCGCGCGCATCGCTTGCCGGCCGGCGTGCCGAGCGGTACTACGGCTACGAGCTGCTCGTGCGGCCAT
GGCTGTGGCTCGCGACGCGTCGCTCCGATTGCCGGATATTCCAGAACAAGACCGTGCCCGAGATCGTGCA
GGAGGTGCTGTCGACGTACGGCTTTCCGATCGAGAACCACCTCGCCGAATCGTATGTGCCGCGCGAGTAT
TGCGTGCAGTACAACGGGACCGATGCCGCGTTCGTGTCGCGGCTGATGGAATTCGAGGGCATCTACTACT
GGTTCCGGCATGCCGAGGACACGCATACGCTGATGCTGAGCGACGCGATGTCGTCGCATACGGCGCTGCC
CGGCTACGAAACGATTCCGTACATCGCGCGCGACCGCACCGTGATCGCCGACGTGGAACATATCGACGGC
TGGCTGCCCGCGCGACAGGTGAGCGTCGGCAAGCATCAGACCACCGACTACGACTACACGAAACCACGCG
CCGATCTGTCGTCGCAGAAGGTCGATCCGCGCGGCCACGATCACGACAGCTTCGCGTCGTTCGAATGGCC
GGGCGGCTATCGCGACGATGCGCCCGGCGCGCACTACAGCCGCGTGCGGCTCGAAGAACAGCAGGCCGAG
CACGAACGCGCGAGCGCCGATACGGATGTGCGCGGCGCCGCGCCGGGGTATCTGTTCACGCTCGCGCATT
GCCCGCGCGCCGACCGGAACCGCGAGTACCTGATCGTGCGGTGCCAGTACCGTTTTCAGGAGAACGCGTA
TGCGAGCGATCAGGGCACGGAGGCTGTGGTGCATCAGACGATGATGCTCGTGCGGCCGTCGAGTTTGCCT
TATCGGTCGCCGCGTGAGACGCCGAGACCGCGGACCAACGGGCCGCAGACGGCGACCGTTGTCGGGCCGC
CCGGTGAGGAAATCTGGACCGATCAGTACGGGCGCGTGAAGCTGCAGTTTCGCTGGGACAGGTATGGGCA
GAGCAACCAGGATTCGTCGTGCTGGGTGCGGGTGTCGAGCCCGTGGGCGGGCGGTGGATTCGGAGGCGTG
CAGATTCCGCGTGTGGGCGACGAGGTCGTGGTCGATTTTCTGAACGGCGATCCGGATGAGCCGATCGTGA
CGGGGCGCGTTTATAACGGCGAGCGGATGCCGCCGTGGGGGCTGCCGGGGAGTGCGACGCAGAGCGGGCT
GTTGTCGCGGTCGTCGCCGGGCGGGACGACCGAGCATGCGAACGCGTTTCGCTTCGAGGACAAGAAAGGC
GCGGAACAGTTGTGGATGCACGCGGAGCGGAATTTCGACGCGGAAACGGAGGCCGATCATTCGCTTTCCA
TCGAGCACGACCACACGCATACGGTCGGCAACGACGAAACGATGCAGGTGAGGAACAACCGGCAACGCAG
CGTCGGGCAGGACGAGACGGTGAACATCGGGCGGCATCGGGTCGCGCAGATCAAGGGGAATGAGACGCAG
GGGGTGGTGGGGGATCGCACGCGCACGGTCGGGAAGAAGGAGACCGTGACGATCGTGTCGGATCGCGAGG
CGACGATCGGCGGCAATCACATGGAGACGGTCGTGAAAGACAAGACCGAATCGATCGGCGAGGGCAAGAC
GCTGAATGTCGTCAAGCACTATCAGACGAATTCGAAAAGCATGAAGACGACGGTCGCTGAACATCATGTG
GAGGAGATCGGTGAGCGGACGTCGACGATTGCACACGCGCATACGCTCACGGTCCGCGGCGAACACGCCG
TCAGCGTCGGCGCAAACCACACGACGAACGTGCAGCATCAGGTGCTCGTCAATGCCGGCGACCAGCGTGC
GCTCGTGTGCGGGAAGTCGAGCGTCCTGATGAAGAGCGACGGCACGATCCTGATCCAGGGTGTCAACGTC
GAATCAAGCGGCTCCGACAGCCACAGCGTGCGCGGCAAGAAGGTCACGTCATCGGCGTCGGTCGAGCATA
CGGTCGAAGGGACCGTGTTGAAGCTGAATCCGTAA