SecReT6
Protein ID: 403524069
SecReT6 ID698
T6SS typei3
Gene symbol-
Locus tagBPC006_II2791
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2822405..2824600 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDK7Q3P7
KEGG IDbpq:BPC006_II2791
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-85, Aligned region: 20..322
Phage_GPD [PF05954], Evalue: 1.50E-85, Aligned region: 575..638
Phage_base_V [PF04717], Evalue: 1.00E-25, Aligned region: 361..453
Gp5_C [PF06715], Evalue: 4.40E-09, Aligned region: 507..522
Gp5_C [PF06715], Evalue: 4.40E-09, Aligned region: 513..536
Gp5_C [PF06715], Evalue: 4.40E-09, Aligned region: 527..544
Gp5_C [PF06715], Evalue: 4.40E-09, Aligned region: 553..576
Gp5_C [PF06715], Evalue: 4.40E-09, Aligned region: 578..600
Gp5_C [PF06715], Evalue: 4.40E-09, Aligned region: 643..661
Gp5_C [PF06715], Evalue: 4.40E-09, Aligned region: 712..724
Protein Sequence: 731 a.a.     [Download]
>gi|403524069|ref|YP_006659638.1| Rhs element Vgr protein [Burkholderia pseudomallei BPC006]
MFTLDSLHGDDLKFHRLYGEEALGRMFDFRIEALADNHSLSLKELLGKPVTVRIRQQDESERHLNGIVAR
AALVGRRAERHYGYQLIVRPWLWLATRRSDCRIFQNKTVPEIVQDVLGTYGFPIENHLTDTYAPRDYCVQ
YNETDAAFVSRLMEFEGIYYYFKHAAQTHTLMLCDAMASHVALPGYEHIPFIARDRTAIADEEHIDSWLP
AQEVSIGKHETSDYDYTKPRADLSAQKIDPRGHDHDGFASFEWPGGYRDDEPGAHYSRVRLEEQQAEHER
ALARTDVRGIAPGYLFTLEHCPRADQNREYLIVRCQYRFQENAYATDSGNEAVVHESQTLVQPSSLPYRS
PRATPRPRTNGPQTATVVGPKGEEIWTDQYGRVKLQFRWDRYGQSDQNSSCWVRVSSPWAGGGFGGVQIP
RIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGLPGSATQSGLLSRSSPGGTAEHSNAFRFEDKKGAEQ
LWMHAERNFDAETEQDHTLSVGHDHSHSVGNNEMMSVANDRQRSVGQNETVNIGKHRVAQIGGNETHGVA
GNRTRQVGQNEAVTIGANREATIGGNHVETVAKDQTETIGQGKTLNVTQHYQTTSKSMKTAVAEHHAEEI
GSRTSTIEKAHELNVGGSQSVNVGASHTMSVKNNVHVGAGDQISLVCGDASITLKKDGTIAINGVTVESS
ASGSHSVRGKTVTSSATGEHTVEGTILKLNP
 
Nucleotide Sequence: 2196 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c2824600-2822405 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
GTGTTCACACTCGACAGCCTGCACGGCGACGACCTGAAGTTCCACCGGCTCTACGGCGAGGAAGCGCTCG
GGCGGATGTTCGACTTCCGGATCGAAGCGCTCGCCGACAATCACAGCCTGTCGCTGAAGGAACTGCTCGG
CAAGCCGGTGACGGTGCGCATCCGGCAGCAGGACGAATCGGAGCGCCATCTGAACGGGATCGTCGCGCGC
GCCGCGCTGGTCGGGCGGCGCGCGGAGCGGCATTACGGCTATCAACTGATCGTGCGGCCGTGGCTGTGGC
TCGCGACGCGCCGCTCCGATTGCCGGATCTTCCAGAACAAGACGGTGCCGGAGATCGTGCAGGACGTGCT
CGGCACGTACGGCTTTCCGATCGAAAACCATCTGACCGACACGTACGCGCCGCGCGACTACTGCGTGCAG
TACAACGAGACCGACGCGGCGTTCGTGTCGCGGCTGATGGAGTTCGAAGGGATCTACTACTACTTCAAGC
ACGCCGCGCAAACGCACACGCTGATGCTGTGCGACGCGATGGCGTCGCACGTCGCGCTGCCGGGCTACGA
GCACATTCCGTTCATCGCGCGCGACCGCACCGCGATCGCCGACGAAGAGCACATCGACAGCTGGCTGCCC
GCGCAGGAAGTGAGCATCGGCAAGCACGAGACGAGCGACTACGACTACACGAAGCCGCGCGCGGATCTGT
CCGCGCAGAAGATCGATCCGCGCGGCCACGACCATGACGGCTTCGCGTCGTTCGAATGGCCCGGCGGCTA
TCGCGACGATGAACCGGGCGCGCATTACAGCCGCGTGCGGCTCGAAGAGCAGCAGGCGGAGCACGAACGC
GCGCTCGCGCGCACCGACGTGCGCGGCATCGCACCCGGCTATCTGTTCACGCTCGAACACTGCCCGCGCG
CCGACCAGAACCGCGAATACCTGATCGTGCGCTGCCAGTATCGGTTTCAGGAGAACGCGTACGCGACCGA
TAGCGGCAACGAGGCGGTCGTGCACGAATCTCAGACACTCGTGCAGCCTTCGAGCCTGCCGTATCGCTCG
CCGCGCGCGACGCCGCGGCCGCGCACGAACGGCCCGCAGACGGCGACCGTCGTCGGCCCGAAGGGCGAGG
AAATCTGGACGGACCAGTACGGGCGCGTGAAGCTGCAATTTCGCTGGGACCGCTACGGGCAGAGCGACCA
GAACTCGTCGTGCTGGGTGCGCGTGTCGAGCCCGTGGGCGGGCGGCGGCTTCGGCGGCGTGCAGATCCCG
CGCATCGGCGATGAGGTGGTGGTCGATTTCCTGAACGGCGACCCCGATCAGCCGATCGTGACGGGGCGCG
TGTACAACGGCGAGAAGATGCCGCCATGGGGGCTGCCCGGCAGCGCGACACAAAGCGGGCTGCTGTCGCG
CTCGTCGCCGGGCGGCACGGCCGAGCATTCGAACGCGTTTCGCTTCGAGGACAAGAAGGGCGCGGAGCAG
CTGTGGATGCATGCGGAGCGCAACTTCGACGCGGAGACCGAGCAGGACCACACGCTGTCGGTGGGCCACG
ATCATTCGCATTCGGTCGGCAACAACGAGATGATGAGCGTCGCGAACGACCGGCAAAGGAGCGTCGGGCA
GAACGAGACGGTGAACATCGGGAAACATCGCGTCGCGCAGATCGGCGGGAACGAGACGCATGGCGTCGCG
GGAAACCGCACGCGGCAGGTCGGACAGAACGAAGCCGTGACGATCGGCGCGAATCGCGAGGCGACGATCG
GCGGCAATCACGTGGAGACGGTCGCGAAAGACCAGACCGAAACGATCGGGCAGGGCAAGACGCTGAATGT
CACTCAGCACTATCAGACGACTTCGAAGAGCATGAAGACCGCTGTCGCCGAACATCACGCCGAGGAGATC
GGCTCGCGAACGTCGACGATCGAGAAAGCGCACGAGCTCAACGTTGGCGGTTCTCAATCGGTGAACGTTG
GCGCGAGCCACACGATGAGCGTGAAGAACAACGTACATGTCGGCGCGGGCGATCAGATCTCGCTCGTTTG
CGGCGATGCGAGCATCACGCTGAAGAAGGACGGCACGATAGCGATCAACGGCGTCACGGTGGAATCGAGC
GCCAGCGGAAGCCATAGCGTGCGCGGCAAGACAGTGACGTCGTCGGCGACGGGCGAGCACACGGTGGAAG
GCACGATACTGAAACTGAACCCCTGA