SecReT6
Protein ID: 403524071
SecReT6 ID698
T6SS typei3
Gene symbol-
Locus tagBPC006_II2793
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2827285..2828730 [-]
Producthypothetical protein
NoteTssG
UniProt IDK7QAA7
KEGG IDbpq:BPC006_II2793
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.50E-130, Aligned region: 85..439
Protein Sequence: 481 a.a.     [Download]
>gi|403524071|ref|YP_006659640.1| hypothetical protein BPC006_II2793 [Burkholderia pseudomallei BPC006]
MTTNPKPEPAGVDAGSHANSNAGRRAGAAANVEANAEPDAMPNALRGAAADVAPSAAPSATPNATPSATS
QAAAARRDAWWRRLRAAPHGYDLFHALRWLDALSPEHAPSGYASRPRDEPVRFGQAPSLAFAAAMLADVR
DDGPRPRVAIHGFGLFGPNGPLPSHLTEYAYERATQHDDPTFAAFADLFHHRLILLFYRAWADAQPTVSL
DRPARARFDRYVASLIGPCDALLADSPRGSRPDSSFASSSDSLPDSPPDSSPDSRSDSRSDSPSDAHLDP
HPDSPRGAGALAPHAKYHQAGHLVRHTRNPEGLVQILRRYFGVRVRIVEHVPHWVMLDRAQRCAIRATRP
TQPLGGAVLGRAVRDAQSRFRIVLGPLTLDEYRQFLPGGVHARQLAQWVREYVGIEFDWDVQLELARGEV
PTLALGSRHGLGRTAWLGERLGPGPARDLVLGYDERMRASRARSGAADQAAAAGAFDRQPA
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c2828730-2827285 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGACGACGAACCCGAAACCGGAGCCCGCCGGCGTGGACGCGGGCTCGCACGCGAACTCGAATGCGGGCC
GGCGCGCCGGTGCGGCCGCGAATGTGGAGGCGAACGCGGAGCCGGACGCGATGCCGAATGCGCTCCGGGG
CGCGGCTGCGGATGTCGCGCCAAGCGCGGCGCCGAGCGCGACGCCAAATGCAACGCCGAGCGCGACGTCG
CAGGCCGCCGCCGCGCGCCGCGACGCATGGTGGCGCCGCCTGCGCGCCGCGCCGCACGGCTACGACCTGT
TTCATGCGCTGCGTTGGCTCGATGCGCTGTCGCCCGAGCACGCGCCGTCCGGCTACGCGTCGCGGCCGCG
CGACGAGCCGGTGCGCTTCGGCCAGGCGCCGTCGCTCGCGTTCGCGGCCGCGATGCTCGCCGACGTGCGT
GACGACGGCCCGCGCCCGCGCGTCGCGATTCACGGCTTCGGGCTGTTCGGGCCGAACGGGCCGCTGCCGT
CGCATCTGACCGAGTACGCATACGAGCGCGCGACGCAGCATGACGATCCGACCTTCGCCGCGTTCGCCGA
CCTGTTTCATCATCGGCTGATCCTGCTGTTCTATCGCGCATGGGCCGATGCGCAGCCGACCGTCAGCCTC
GATCGGCCGGCGCGCGCGCGGTTCGACCGCTACGTGGCCAGCCTGATCGGGCCGTGCGACGCGTTGCTTG
CCGATTCACCGCGCGGCTCACGGCCCGATTCGTCCTTCGCTTCGTCGTCCGATTCACTGCCTGATTCACC
GCCTGATTCATCGCCTGATTCGCGGTCTGATTCGCGGTCCGATTCCCCGTCCGATGCGCACCTCGATCCG
CATCCCGACTCGCCGCGCGGCGCTGGCGCGCTCGCGCCGCACGCGAAGTATCACCAGGCCGGCCATCTGG
TGCGGCACACGCGCAACCCGGAGGGGCTCGTGCAGATCCTGCGGCGCTATTTCGGTGTGCGGGTACGCAT
CGTCGAGCACGTGCCGCACTGGGTGATGCTCGATCGCGCGCAGCGCTGCGCGATCCGCGCGACGCGGCCG
ACGCAGCCGCTCGGCGGCGCCGTGCTCGGCCGTGCGGTGCGCGACGCGCAGTCGCGCTTCCGGATCGTGC
TCGGCCCGCTGACGCTCGACGAATACCGGCAGTTCCTGCCGGGCGGCGTCCATGCGCGGCAGCTCGCGCA
ATGGGTGCGCGAATACGTCGGCATCGAATTCGACTGGGACGTGCAGCTCGAGCTCGCGCGCGGCGAAGTG
CCGACGCTCGCGCTCGGCAGCCGTCACGGGCTCGGCCGCACCGCATGGCTCGGCGAGCGGCTCGGCCCCG
GCCCCGCGCGCGACCTCGTGCTCGGCTACGACGAGCGCATGCGCGCTTCGCGCGCACGATCGGGCGCGGC
CGATCAGGCGGCCGCCGCCGGTGCGTTTGATCGCCAACCTGCCTGA