SecReT6
Protein ID: 403524073
SecReT6 ID698
T6SS typei3
Gene symbol-
Locus tagBPC006_II2795
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2830603..2831151 [-]
Producthypothetical protein
NoteTssE
UniProt IDK7QCJ0
KEGG IDbpq:BPC006_II2795
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-22, Aligned region: 46..160
Protein Sequence: 182 a.a.     [Download]
>gi|403524073|ref|YP_006659642.1| hypothetical protein BPC006_II2795 [Burkholderia pseudomallei BPC006]
MNDDVRAAGGVRAAHDRLQPALLDRLTDAERERRTEPPDAQAIGGERLRAAVLRDLAWLLNTRNGEDGFV
DWSAFAHAQASVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEPRIAPDSVEVRSVLDAPGGAAGERR
HNVLMFEIKGTLWSIPHPVEFVLRSDLDLETGAMALHPAAGG
 
Nucleotide Sequence: 549 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c2831151-2830603 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGAATGACGACGTGCGAGCCGCGGGCGGCGTGCGCGCCGCGCATGACCGGCTGCAGCCGGCGCTGCTCG
ACCGGCTGACCGACGCCGAGCGCGAGCGGCGCACCGAGCCGCCCGACGCGCAGGCGATCGGCGGCGAGCG
CCTGCGCGCGGCGGTGCTGCGCGATCTGGCGTGGCTGCTCAACACGCGCAACGGCGAGGACGGCTTCGTC
GACTGGTCGGCGTTCGCGCACGCGCAGGCGTCGGTGCTCAACTACGGGATGCGGCCGCTCGTCGGCAAGC
CGATGTCGGGCGTCGAGCGGATGTCGGTCGAGGCGTCGATCCGCGATGCGATCGTGCGTTTCGAGCCGCG
TATCGCGCCCGACAGCGTCGAGGTGCGCAGCGTGCTCGACGCGCCGGGCGGCGCGGCGGGCGAGCGCCGG
CACAACGTGCTGATGTTCGAGATCAAGGGCACGCTGTGGTCGATTCCGCATCCGGTCGAGTTCGTGCTGC
GCTCGGACCTCGATCTGGAGACGGGCGCGATGGCGCTGCACCCGGCGGCGGGAGGCTGA