SecReT6
Protein ID: 403524074
SecReT6 ID698
T6SS typei3
Gene symbol-
Locus tagBPC006_II2796
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2831170..2831661 [-]
Producthypothetical protein
NoteTssD
UniProt IDK7Q3Q3
KEGG IDbpq:BPC006_II2796
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.80E-34, Aligned region: 6..138
Protein Sequence: 163 a.a.     [Download]
>gi|403524074|ref|YP_006659643.1| hypothetical protein BPC006_II2796 [Burkholderia pseudomallei BPC006]
MGVAMFMKVDGVTGESADAQHKGWTDIQSFSWGASQPGAMASGSGGNAGKASFNDLVVAAYMDKGATAII
KNCASGKHLPTVEISACKTGGSQIEFMRVTLQEVLVTSAQIAGVDPGDAADRLMMQYGFQAAKVKKQYWQ
QNDNGGKGAEVSVGWNIKENTEM
 
Nucleotide Sequence: 492 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c2831661-2831170 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGGGCGTCGCAATGTTTATGAAAGTGGACGGCGTCACCGGCGAATCGGCCGACGCGCAGCACAAGGGCT
GGACCGACATCCAGTCGTTCTCATGGGGCGCGAGCCAGCCGGGCGCGATGGCGAGCGGCAGCGGCGGCAA
CGCGGGCAAGGCGAGCTTCAACGATCTCGTCGTCGCCGCGTACATGGACAAGGGCGCAACGGCGATCATC
AAGAACTGCGCGAGCGGCAAGCACCTGCCGACGGTCGAGATATCGGCGTGCAAGACGGGCGGCTCGCAGA
TCGAGTTCATGCGCGTGACGCTGCAGGAAGTGCTCGTCACGTCCGCGCAGATCGCGGGCGTGGACCCGGG
CGACGCGGCCGACCGGCTGATGATGCAGTACGGTTTTCAGGCCGCGAAGGTCAAGAAGCAGTACTGGCAG
CAGAACGACAACGGCGGCAAGGGCGCCGAAGTGTCGGTCGGCTGGAACATCAAGGAGAACACCGAGATGT
GA