SecReT6
Protein ID: 403524081
SecReT6 ID698
T6SS typei3
Gene symbol-
Locus tagBPC006_II2804
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2842379..2843695 [-]
Producthypothetical protein
NoteTssL
UniProt IDK7QAB2
KEGG IDbpq:BPC006_II2804
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 49..253
DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 335..363
DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 376..417
OmpA [PF00691], Evalue: 9.90E-15, Aligned region: 250..259
OmpA [PF00691], Evalue: 9.90E-15, Aligned region: 318..416
Protein Sequence: 438 a.a.     [Download]
>gi|403524081|ref|YP_006659650.1| hypothetical protein BPC006_II2804 [Burkholderia pseudomallei BPC006]
MNTSSDSFSAGSGGFVPPNPGGAHPAAAPAAGAAAFQPRPGRWAASGTNPLVAAANPLLNLVPQIRSTVH
HPNPAWLREHLVVEIRQFEERAQQAGVASEAIIGARYCLCTALDEAAALTPWGGSVWSSHSLLVSFHNET
WGGEKFFHLLERLSQQPRQHLDLLELLYFCLALGFEGRYRVLDNGRAQLDAVRRQLAQTIRSVRGEFDPA
LSPHWRDVVTRDVTRRFTVPLWVCVALALLVGFGVFAGLRIALAGHSDRLFASIDALHVPKLQPAPPAPH
PAPAPRVAKFLEPEIAAGLVSVRDEADRSVIVLRGDGLFGSGSTSVIDRYMPVLTRVADALNQVQGNVRV
SGYTDDTPVHTARFASNWDLSRERAQAVRSLIAARLDRPERITAEGRGTLDPVAPNDSPANRARNRRVEI
TLMLAPGSDAARATKEAP
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c2843695-2842379 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGAACACTTCTTCCGATTCGTTCTCGGCCGGCTCGGGCGGATTCGTGCCGCCGAATCCGGGCGGCGCGC
ACCCGGCCGCCGCGCCGGCGGCGGGTGCGGCCGCGTTTCAGCCGAGGCCGGGCCGCTGGGCGGCGAGCGG
CACGAATCCGCTCGTCGCGGCCGCGAACCCGCTGCTGAACCTCGTGCCGCAGATCCGTTCGACCGTCCAT
CATCCGAATCCCGCGTGGCTGCGCGAGCATCTCGTCGTCGAGATCCGCCAGTTCGAGGAGCGCGCGCAGC
AGGCGGGCGTCGCCTCCGAGGCGATCATCGGCGCGCGCTACTGCCTGTGCACCGCGCTCGACGAGGCCGC
CGCGCTGACGCCGTGGGGCGGCAGCGTGTGGTCGTCGCATAGCCTGCTCGTGTCGTTCCACAACGAGACG
TGGGGCGGCGAGAAGTTCTTCCATCTGCTCGAGCGGCTGTCGCAGCAGCCGCGCCAGCATCTCGACCTGC
TCGAGCTGCTGTACTTCTGCCTCGCGCTCGGCTTCGAGGGGCGCTATCGCGTGCTCGACAACGGCCGCGC
GCAGCTCGACGCGGTGCGCCGCCAGCTCGCGCAGACGATCCGCTCGGTGCGCGGCGAATTCGATCCGGCG
CTCTCGCCGCATTGGCGCGACGTCGTCACGCGCGACGTCACGCGGCGCTTCACGGTGCCGCTGTGGGTGT
GCGTCGCGCTCGCGCTGCTCGTGGGCTTCGGCGTGTTCGCGGGGCTGCGCATCGCGCTCGCCGGCCATTC
GGATCGGCTGTTCGCGTCGATCGACGCGCTGCACGTGCCGAAGCTGCAGCCGGCGCCGCCCGCGCCGCAT
CCGGCGCCCGCGCCGCGCGTCGCGAAGTTCCTCGAGCCGGAGATCGCCGCGGGGCTCGTGAGCGTGCGCG
ACGAGGCCGACCGCAGCGTGATCGTGCTGCGCGGCGACGGCCTGTTCGGCTCCGGCTCGACGTCGGTGAT
CGATCGCTACATGCCGGTGCTCACGCGCGTGGCCGACGCGCTGAACCAGGTGCAGGGCAACGTGCGCGTG
AGCGGCTACACCGACGACACGCCGGTGCACACCGCGCGCTTCGCGTCGAACTGGGATTTGTCGCGCGAGC
GCGCGCAGGCGGTCCGCAGCCTGATCGCCGCGCGGCTCGACCGCCCCGAGCGGATCACCGCCGAAGGGCG
CGGCACGCTCGATCCGGTCGCGCCGAACGATTCGCCCGCGAACCGCGCGCGCAACCGGCGCGTCGAGATC
ACGCTGATGCTCGCGCCCGGCAGCGACGCCGCGCGCGCGACGAAGGAGGCGCCCTGA