SecReT6
Protein ID: 403524083
SecReT6 ID698
T6SS typei3
Gene symbol-
Locus tagBPC006_II2806
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2845111..2845545 [-]
Productlipoprotein
NoteTssJ
UniProt IDK7QCJ2
KEGG IDbpq:BPC006_II2806
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.70E-35, Aligned region: 3..132
Protein Sequence: 144 a.a.     [Download]
>gi|403524083|ref|YP_006659652.1| lipoprotein [Burkholderia pseudomallei BPC006]
MPYSITLDVAPDVNPDLNRKPSPIVLKVFQLKTASAFESADFFSLQDKPQSVLGADLLGVDRIILRPGDA
RTLHYRGNVDAGAIGIVAEYRVLEKNRWRMTVPLPRAKQLNLYRFWQTSPGEMKLQVAVKNGGIGLGGDS
RVRQ
 
Nucleotide Sequence: 435 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c2845545-2845111 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
GTGCCGTATTCGATCACGCTCGACGTCGCGCCCGACGTCAATCCGGACCTCAATCGCAAGCCGTCGCCGA
TCGTGCTGAAGGTGTTCCAGCTGAAGACGGCGTCCGCGTTCGAAAGCGCCGATTTCTTCTCGCTGCAGGA
CAAGCCGCAGAGCGTGCTCGGCGCGGATCTGCTCGGCGTCGACCGGATCATCCTGCGCCCGGGGGATGCG
CGCACGCTGCACTATCGCGGCAACGTCGACGCGGGCGCGATCGGCATCGTCGCCGAATATCGCGTGCTCG
AGAAGAACCGCTGGCGGATGACGGTGCCGCTGCCGCGCGCGAAGCAACTGAACCTGTACCGATTCTGGCA
AACCTCGCCGGGCGAGATGAAGCTGCAGGTCGCCGTGAAGAACGGCGGCATCGGCCTCGGCGGCGATTCG
CGAGTACGCCAATGA