SecReT6
Protein ID: 403524085
SecReT6 ID698
T6SS typei3
Gene symbol-
Locus tagBPC006_II2808
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2846725..2848161 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDK7QAV8
KEGG IDbpq:BPC006_II2808
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.50E-10, Aligned region: 29..96
Protein Sequence: 478 a.a.     [Download]
>gi|403524085|ref|YP_006659654.1| FHA domain-containing protein [Burkholderia pseudomallei BPC006]
MQLTVIEHAGEPVGTDGRNAVVFHAPGGTIGRDSDNHLVLRDDTRQISRLQALLQVADDACLLKNLSSVS
TIEVNRVPIGYAQAQRLNMGDIIRIGPYLLRAEPDDATIERTVEAAATGAAAAAPAASAAQAQAKGAGNK
LWGLLHERFGLGKAQGAGEQSGARAAPARHHDSPASAAPRDLNQLSTDPLDLFAQPHGDPDARAGAAREG
EDRAPPTVTQPDHAPEWTQHVRVQPAQSAPPAASRPGAPAARSGDIPAAGDASDMPSRVRASPAPAPATP
ETLLQAFFEGAGLDTAAEQHHWSAEQLFVAGQLLALFANGTVELLSSRSILKREVKADMTMLLDRENNPL
KLLPDGSAVLRQMFGLPLPGFMTPQSAVSDAFQDLHAHQIGMVAGMRAALMDLLTRFSPQRLRERDAAPQ
WYEKRVPALYKARLWDRYATTHRDTLFAIEDDFASVFGKAFLSAYDAEVESYRGRCRR
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|403521294|ref|NC_018529.1|:2846725-2848161 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGCAACTGACCGTTATCGAACACGCGGGCGAGCCGGTCGGCACCGACGGCCGCAACGCCGTCGTGTTTC
ATGCGCCGGGCGGCACCATCGGCCGGGACAGCGACAATCACCTCGTGCTGCGCGACGACACCCGGCAAAT
CTCGCGCCTGCAGGCGCTGCTGCAGGTGGCCGACGACGCGTGCCTGCTGAAGAACCTGAGCAGCGTATCG
ACGATCGAAGTGAACCGCGTGCCGATCGGCTACGCGCAGGCGCAGCGCCTGAACATGGGCGACATCATCC
GGATCGGCCCTTACCTGCTGCGCGCGGAGCCCGACGACGCGACGATCGAGCGAACCGTCGAAGCCGCCGC
CACGGGGGCCGCGGCGGCGGCGCCGGCGGCGTCCGCCGCGCAGGCTCAGGCGAAGGGGGCGGGCAACAAA
CTGTGGGGCCTGTTGCACGAGCGCTTCGGGCTCGGCAAGGCACAGGGCGCGGGCGAGCAGTCCGGCGCGC
GCGCCGCGCCGGCGCGCCACCACGATTCGCCGGCGTCCGCCGCGCCGCGCGACCTGAATCAGCTGTCGAC
CGATCCGCTCGACCTGTTCGCGCAGCCGCACGGCGATCCGGATGCGCGAGCCGGCGCCGCGCGCGAAGGC
GAAGACCGCGCGCCGCCCACCGTCACGCAACCGGATCACGCGCCCGAGTGGACGCAACACGTCCGCGTGC
AGCCGGCACAATCCGCGCCGCCCGCCGCCTCTCGCCCCGGCGCGCCCGCCGCGCGTTCGGGCGATATCCC
CGCAGCGGGCGATGCGAGCGACATGCCGTCGCGCGTGCGCGCGTCGCCGGCCCCCGCGCCGGCGACACCC
GAGACATTGCTGCAGGCGTTCTTCGAAGGCGCGGGGCTCGACACCGCCGCCGAGCAGCATCACTGGTCCG
CCGAGCAGTTGTTCGTCGCGGGGCAACTGCTCGCGCTGTTCGCCAACGGCACGGTCGAGCTGCTGTCGTC
ACGCAGCATCCTGAAGCGCGAAGTGAAGGCCGACATGACGATGCTGCTCGACCGCGAGAACAATCCGCTG
AAGCTGCTGCCGGACGGCAGCGCGGTGCTGCGCCAGATGTTCGGGCTGCCGCTGCCGGGCTTCATGACGC
CGCAAAGCGCCGTGTCCGACGCGTTCCAGGATCTGCACGCGCACCAGATCGGCATGGTGGCCGGCATGCG
CGCCGCGCTGATGGATCTGCTCACGCGCTTCTCGCCGCAGCGCCTGCGCGAGCGCGACGCCGCGCCCCAG
TGGTACGAGAAGCGCGTGCCGGCGCTGTACAAGGCGCGCCTCTGGGACCGCTATGCAACCACGCATCGCG
ACACGCTGTTCGCGATCGAGGACGATTTCGCCTCCGTGTTCGGCAAGGCGTTCCTCAGCGCCTACGACGC
GGAAGTCGAGAGCTATCGCGGACGCTGCCGCCGGTGA