SecReT6
Protein ID: 407467677
SecReT6 ID704
T6SS typei1
Gene symbol-
Locus tagO3O_04925
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]4234232..4235563 [+]
Producthypothetical protein
NoteTssK
UniProt IDK0BI06
KEGG IDeso:O3O_04925
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.80E-148, Aligned region: 20..442
Protein Sequence: 443 a.a.     [Download]
>gi|407467677|ref|YP_006785881.1| hypothetical protein O3O_04925 [Escherichia coli O104:H4 str. 2009EL-2071]
MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNDLSWGFTELTLNNELLAQGKIMIDSASGTL
PDGTVFSIPDQDALPDPLHPQHFPDERSRNIYLALPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGD
TRTLTLGQLTPRIMSGAEDMSAYITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAI
GGRASDLANRIGSPAQSGIADVAEFMMLQLLNRNQTRFTHHARRSQLHPEDFYLDLAGLLGELMTFTEPS
RLPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADIHDTELLQSATFVLAVAA
NMPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYHSGFSYFELDKSGQAWTEMAAA
GAVALHVSGSFPDLNMQLWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|407466711|ref|NC_018661.1|:4234232-4235563 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGGCAACCACCCGCAACAAGGTGATGTGGCAGGAAGGGATGCTGATGCGTCCACACCATTTCCAGCAGC
AGCAGCGTTACAACGACTACCTGGATAACCAGCGTTTCCGGGCCATGAATGATTTATCCTGGGGATTTAC
CGAACTCACTCTCAACAATGAACTGCTGGCACAGGGTAAGATCATGATTGACAGCGCGTCAGGCACACTG
CCCGACGGCACCGTCTTTTCTATCCCCGACCAGGACGCACTGCCCGATCCGCTGCACCCGCAACATTTTC
CGGACGAGAGAAGCCGCAATATCTACCTCGCTCTGCCGGTCGCCAGTGATGTGAGAAATGAAATCAGCGA
CGGGCGGCGAATCGGGCGTTACCGGCTGAATTATGCCGATGTCCGGGATTTGCATTCAGAAGAAGGTGAC
ACGCGAACACTGACGCTGGGACAACTGACGCCGCGCATTATGAGCGGTGCAGAAGATATGAGCGCCTATA
TTACGCTCCCGCTTTGCCGTATCAGCGATCGCCATGCCGACGGCTCCCTGACGCTGGATGACGATTTTAT
CCCCTCCTGCCAGAATATTCAGGTCAGTAAGAAACTGCGTGTTTATCTCAAAGAGGTACAGGGGGCCATT
GGCGGACGGGCAAGCGATCTGGCAAACCGCATTGGCTCTCCGGCGCAGAGCGGCATCGCGGATGTGGCGG
AATTTATGATGTTGCAGTTACTTAACCGTAACCAGACCCGGTTTACCCATCACGCCCGTCGATCCCAGCT
CCACCCGGAAGATTTCTACCTTGATCTTGCCGGGTTGCTGGGTGAACTGATGACCTTTACCGAGCCGTCG
CGCCTGCCCTGCCCGCTTGATGTGTATGATCATCATGACCTGACCAAAACATTTAAAACGCTGTTACCGG
AAGTCAAACGGGCGCTGCATACCGTACTGTCGCCAAGAGCCGTCAATCTGCCGCTGCATCTGCGTGACGG
TATCTGGCAGGCCGATATCCATGACACAGAACTGCTGCAATCTGCCACCTTTGTGCTGGCCGTGGCGGCA
AACATGCCGGTCGATCAGATCCAGCGCCAGTTTATCCAGCAGTCGAAAATTTCCTCGCCGGAAAAAATCC
GCAATATGGTCAGTGTGCAGATCCCCGGCATTCCATTGCGCGCACTGATGGTGGCTCCCCGCCAGCTTCC
TTACCATTCCGGGTTCAGCTATTTCGAACTCGACAAGAGCGGACAGGCCTGGACAGAAATGGCTGCCGCC
GGGGCCGTTGCACTGCATGTATCCGGCAGTTTCCCGGATCTGAACATGCAACTGTGGGCGATAAGAGGGT
AA