SecReT6
Protein ID: 407467679
SecReT6 ID704
T6SS typei1
Gene symbol-
Locus tagO3O_04935
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]4232428..4233708 [+]
Producttype VI secretion system protein ImpI
NoteFha
UniProt IDK0BH33
KEGG IDeso:O3O_04935
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 426 a.a.     [Download]
>gi|407467679|ref|YP_006785879.1| type VI secretion system protein ImpI [Escherichia coli O104:H4 str. 2009EL-2071]
MPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHGPECHWSVQDRQQSIPAQAFTVILHDGTFCLRP
QTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDIPHYDEEMATPETIVTNRDMLTDTLLST
EGTPHYPGMTHRHQLADTVVNGFSADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMD
LPPIYASPGDRNDDVSAAEMAQRHLAVTPLLRGLGGSLTMSNSDDADDFLEEAGRTLQAAIKGLLDLQQQ
RNSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAAIVESLRV
LLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVYDRVLREK
QREPEA
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|407466711|ref|NC_018661.1|:4232428-4233708 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGCCGGAAGAGAAACTACAGACGCTTTCATTGCAGGTCATTAACGGCAGTGAGCTGGAAAGCGGACGGG
CGGCGCGCTGTCTGTTCACACAGCAGGGAAATGTCGGCCATGGCCCCGAATGCCACTGGTCGGTACAGGA
TCGTCAGCAGAGCATTCCGGCCCAGGCTTTTACCGTTATCCTGCACGATGGCACATTTTGTCTGCGCCCG
CAGACGGCACAACTGTGGCTGAATCAGGCAAAAGTCACAGCAACATCAGACCTAATACAGTTGCGCCAGG
GCGATGAGATCCAGATCGGACGGCTGATGGTGAGGGTTCATCTGAACCGGGGAGATATTCCCCATTACGA
TGAGGAAATGGCCACTCCCGAAACCATCGTTACCAATCGCGATATGCTCACGGATACCCTGCTATCAACG
GAGGGTACGCCACACTATCCGGGAATGACTCACCGGCACCAACTTGCAGACACCGTGGTAAACGGTTTTT
CTGCCGATCCACTCCAGGCACTTCAGTCCGAAAGCCTGATTACCACGGGCGATCCGCTTTCAGGCATTGC
GGCTGTCCGGCCATCGGCACCGCTGTCCGATCCGGCAAGTAATGGGGGGATCAATACTCCGTTTATGGAT
CTGCCGCCCATTTATGCCAGCCCCGGCGATCGTAATGACGACGTCTCTGCGGCAGAAATGGCGCAACGCC
ACCTTGCGGTCACCCCCTTACTGCGCGGTCTTGGCGGCTCGCTTACCATGAGCAATTCCGACGATGCGGA
TGATTTTCTGGAGGAGGCCGGACGAACGTTACAGGCCGCAATAAAAGGTCTGCTCGATTTGCAGCAGCAG
CGTAACAGCCTCTCAGACAAACATTTGCGCCCGCTGGAAGATAACCCGCTGCGCCTGAACATGGATTACG
CCACCGCGCTCGACGTAATGTTTGCCGAAGGTAAAAGCCCGGTACATTTGGCGGCTCCCGCCGCCGTCAG
TGAAAGCCTGCGCAATGTCCGCCACCACGAAGAAGCTAACCGGGCAGCGATTGTGGAGTCGCTTCGTGTC
CTGCTGGATGCTTTCTCACCACAAAATCTGCTGCGCCGCTTTGTGCAGTACCGCCGCAGCCATGAACTGC
GCCAGCCGCTGGATGATGCCGGAGCATGGCAAATGTACAGCCATTATTACGAAGAACTGGCCTCCGATCG
CCAGCAGGGGTTTGAGATGCTGTTTAACGAGGTCTACGCCCAGGTCTATGACCGGGTGCTTCGTGAAAAA
CAGCGGGAGCCGGAAGCATGA