SecReT6
Protein ID: 407467681
SecReT6 ID704
T6SS typei1
Gene symbol-
Locus tagO3O_04945
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]4229507..4231357 [+]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDK0BK63
KEGG IDeso:O3O_04945
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.60E-196, Aligned region: 5..616
Protein Sequence: 616 a.a.     [Download]
>gi|407467681|ref|YP_006785877.1| type VI secretion system protein ImpG [Escherichia coli O104:H4 str. 2009EL-2071]
MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEKDADPDIERLLEGVAFLTGNLRQKIEDEFPELTHG
LIKMLWPNYLRPVPAMTLIEYTPDMDKSSVPVLIPRNEQFTTNAGEIRVDEVLPSDAKKEEPPPCTFTLC
RDIWLLPVRLEQIENRSTTRNGVINITFSVAPGTDFRTLDLNKLRFWLGNDDNYTRDQLYLWFCEYLQGA
DLTVGEQHLRLPEFMLKAVGFEPQDAMLPWPKNVHSGYRILQEYFCYPDAFLFFDLCGCPALPDGLQAEF
FTLQLRFSRPLPVDIRLRRDSLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPQHYDVFSVNSVV
SQVQDMFRKKDLGRPVSTQAARQWPAFESFSHQMEYSRKREVVYWHHRTKTSLFHSGFDHTLAFIHADGS
YPSDESLLSNEVVSVSLTCTNRELPSQIRSGDITGTTGKNAAVASFRNITRPTQPLWPVIDGSLHWSLLS
AMNLNYLSLLDTDALKQVIANFDRHAIHHPQTARLSQQKLDAIERLETRPVDRLFTGIPVRGLASTLYLH
PEPFVCEGEMYLLGTVLSHFLSLYASVNSFHMLTVVNTESQETWKWTERIGQHPLI
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|407466711|ref|NC_018661.1|:4229507-4231357 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGGAATTTGAAGAACGCTATTTCCGGGAAGAACTCGATTACCTGCGCCAGCTTAGCAAGCTGCTGGCAA
CGGAAAAACCCCATCTGGCCCGCTTCCTGGCCGAAAAAGATGCGGATCCGGATATTGAACGCCTGCTGGA
AGGGGTGGCTTTTCTTACCGGCAATCTCCGCCAGAAAATTGAGGATGAATTCCCAGAACTGACGCACGGG
CTTATTAAGATGCTATGGCCTAATTACCTGCGTCCGGTTCCGGCAATGACCCTTATTGAATATACGCCGG
ATATGGATAAGTCTTCTGTACCGGTGTTAATCCCCCGTAATGAGCAGTTTACAACCAACGCCGGGGAAAT
CAGAGTTGATGAAGTGCTGCCCTCTGATGCTAAAAAGGAGGAGCCGCCTCCCTGTACCTTCACCCTCTGC
CGGGATATCTGGCTGCTGCCCGTTCGCCTGGAGCAGATTGAAAACCGCAGTACGACCCGTAATGGTGTTA
TCAACATCACCTTTTCGGTCGCACCGGGAACGGACTTCCGCACGCTGGATCTGAACAAACTTCGCTTCTG
GCTCGGCAATGACGACAACTATACCCGTGACCAGCTTTATTTATGGTTCTGCGAATACTTGCAGGGTGCC
GACCTGACTGTGGGTGAACAGCATCTTCGCCTGCCTGAGTTTATGCTAAAAGCTGTCGGTTTTGAGCCGC
AGGATGCCATGCTGCCCTGGCCGAAAAACGTCCACAGCGGCTACCGGATCCTTCAGGAGTATTTCTGTTA
CCCCGATGCGTTTCTCTTTTTTGATCTTTGTGGTTGTCCGGCTTTGCCTGACGGATTGCAGGCGGAATTC
TTTACCCTGCAACTGCGTTTTTCGCGCCCTTTGCCCGTGGACATCCGGCTGCGCCGCGATTCCCTGCGCC
TGTATTGCGCACCTGCCATTAATTTATTTATCCACCATGCAGAAGCCATCACGCTGGACAACCGGCGGGC
AGACTATCCGCTGGTTCCCAGCCGCCATTACCCACAACATTACGATGTATTTTCCGTTAACAGTGTGGTG
AGCCAGGTCCAGGATATGTTCAGGAAAAAAGATCTGGGGCGTCCTGTTTCGACGCAGGCCGCGCGCCAGT
GGCCAGCCTTTGAAAGTTTCAGCCATCAGATGGAATACAGCCGGAAGCGGGAAGTGGTGTACTGGCATCA
CCGGACCAAAACATCCCTGTTCCATAGCGGCTTTGATCATACCCTTGCCTTTATACATGCTGATGGCAGT
TATCCGTCAGACGAATCTCTGCTCAGTAATGAAGTGGTTTCGGTATCGCTGACCTGTACCAACCGTGAGC
TTCCGTCACAAATTCGTTCCGGCGATATCACCGGCACAACCGGTAAAAATGCAGCTGTTGCTTCATTTCG
CAACATTACCCGCCCGACGCAACCACTCTGGCCGGTCATTGATGGCAGCCTGCACTGGTCCCTACTCTCC
GCCATGAACCTGAATTATCTGTCATTACTGGATACGGACGCGCTGAAGCAGGTCATCGCCAACTTTGATC
GCCACGCAATCCATCATCCGCAGACGGCACGGCTGTCACAACAAAAGCTGGATGCCATTGAGCGTCTGGA
GACCCGCCCCGTTGATCGCCTGTTTACGGGTATTCCCGTCCGGGGACTGGCCTCCACGCTGTATCTGCAC
CCGGAGCCGTTTGTCTGTGAAGGGGAAATGTATCTGCTCGGTACGGTGCTTTCGCATTTTCTGTCGCTGT
ACGCCAGCGTTAACTCATTCCACATGCTGACCGTTGTGAACACAGAAAGCCAGGAGACATGGAAATGGAC
GGAAAGAATCGGGCAGCATCCTCTTATCTGA