SecReT6
Protein ID: 407467684
SecReT6 ID704
T6SS typei1
Gene symbol-
Locus tagO3O_04960
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]4227333..4227557 [+]
Producthypothetical protein
NoteTssC
UniProt IDK0BH39
KEGG IDeso:O3O_04960
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.0011, Aligned region: 39..71
Protein Sequence: 74 a.a.     [Download]
>gi|407467684|ref|YP_006785874.1| hypothetical protein O3O_04960 [Escherichia coli O104:H4 str. 2009EL-2071]
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFCEFQQSASHWQ
RVLH
 
Nucleotide Sequence: 225 bp     [Download]
>gi|407466711|ref|NC_018661.1|:4227333-4227557 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGACGGCACACAAAAATATCTCCGGGACATACCACCTCTCTGTTGCAGACATTCTGCAGGTGGTTTACC
AGGTATGTTTCAGCCCGTCCGTTGAAATCAACCAGGATGGTGTGGCTGCGCTGATTACAACACTGGATCG
CCGTATCAGTGATCTATTGGATGAGATTATCCATTTTTGTGAGTTTCAGCAGAGCGCGTCGCACTGGCAG
CGCGTACTTCACTGA