SecReT6
Protein ID: 407467687
SecReT6 ID704
T6SS typei1
Gene symbol-
Locus tagO3O_04975
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]4225583..4226101 [-]
Producthypothetical protein
NoteTssD
UniProt IDK0BI17
KEGG IDeso:O3O_04975
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-34, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.0061, Aligned region: 95..136
Protein Sequence: 172 a.a.     [Download]
>gi|407467687|ref|YP_006785871.1| hypothetical protein O3O_04975 [Escherichia coli O104:H4 str. 2009EL-2071]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPAGQRAHKPFIF
TVALNKAVPLMYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQ
LLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|407466711|ref|NC_018661.1|:c4226101-4225583 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGCCAACACCGTGTTATATCTCCATCACTGGTCAGACCCAGGGAAATATTACTGCAGGTGCATTTACCG
CTGATTCTGTCGGCAACATCTATGTGCAGGGGCACGAAGACGAGATGCTGGTGCAGGAATTCCTGCATAA
CGTTACTGTCCCGACCGATCCTCAGTCCGGTCAGCCTGCGGGTCAGCGTGCTCACAAGCCTTTCATTTTT
ACCGTGGCGCTGAACAAAGCGGTTCCGCTGATGTACAACGCACTGGCCTCCGGCGAAATGCTGCCAACCA
CTGAACTTCACTGGTGGCGTACCTCTGTGGAAGGCAAACAGGAGCATTATTTCACTACCCGCCTGACTGA
TTCGACGATTGTCGATATGAAACTGCATATGCCGCATTGCCAGGACCCGGCGAAACGCGAGTTCACCCAG
TTGCTCGAAGTTTCACTGGCCTACCGCAAAATTGAATGGGAACACGTCAAATCTGGCACCTCCGGTGCCG
ACGACTGGCGCGCACCGCTGGAAGCATAA