SecReT6
Protein ID: 407470881
SecReT6 ID703
T6SS typei4b
Gene symbol-
Locus tagO3O_21220
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]893125..893715 [+]
Producthypothetical protein
NoteTssL
UniProt IDK0BTU0
KEGG IDeso:O3O_21220
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-29, Aligned region: 1..194
Protein Sequence: 196 a.a.     [Download]
>gi|407470881|ref|YP_006782676.1| hypothetical protein O3O_21220 [Escherichia coli O104:H4 str. 2009EL-2071]
MNIVECYMPVFKLISSVRVFPEEYSDYDSTRKNIINTVEEAVRNSEKMSLSDSELDAAFYAVIVMLDEAI
LCSELPCRKEWRDNLLQIKYFGHSTGGVEFFYKLDKVIESGSQAGWVFLLCLLLGFRGKYSVGSNDEINN
YISRLRRQCELNVAIDEGNNISLRKKKYKSSRLGFYLLLVGIVAVYFVVLSMIYMR
 
Nucleotide Sequence: 591 bp     [Download]
>gi|407466711|ref|NC_018661.1|:893125-893715 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
GTGAATATTGTTGAATGCTATATGCCAGTATTTAAACTCATATCATCTGTCAGAGTTTTCCCTGAAGAAT
ATAGTGATTACGACAGTACTAGAAAGAATATAATTAACACTGTTGAGGAGGCTGTTCGCAATAGTGAAAA
AATGTCGTTGAGTGACAGCGAACTTGATGCGGCATTTTATGCTGTAATCGTCATGCTTGATGAGGCAATA
TTGTGTTCAGAGCTTCCCTGTAGAAAAGAATGGCGTGATAATCTTTTGCAGATAAAATATTTCGGACACT
CCACTGGGGGGGTCGAGTTCTTTTATAAACTTGATAAAGTCATCGAATCGGGAAGTCAGGCTGGATGGGT
CTTTCTCCTGTGCCTGTTACTGGGTTTCAGAGGTAAATATTCCGTGGGTAGTAATGATGAAATCAATAAT
TATATATCGAGGCTGAGGCGACAATGTGAATTGAATGTTGCAATCGACGAAGGAAACAATATTTCACTCA
GGAAAAAAAAGTATAAATCATCGAGGCTTGGTTTCTATTTATTACTTGTAGGTATTGTTGCTGTCTATTT
TGTGGTTTTATCCATGATTTATATGAGATGA